Gene Information

Name : SFUL_5317 (SFUL_5317)
Accession : YP_007934095.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5898176 - 5898835 bp
Length : 660 bp
Strand : -
Note : UniProt-pubmed:18252824; UniProt-pubmed:17209016; UniProt-pubmed:17369815; UniProt-pubmed:18375553; UniProt-pubmed:12000953; two component system response regulator; UniProt-pubmed:11759840; UniProt-pubmed:20624727; UniProt-pubmed:20203057

DNA sequence :
ATGAACCGCATTCTGATCGCCGAGGACGAGGAGCGCATCGCCTCGTTCGTCCAGAAGGGGCTGCGCGCCAACGGCTTCAC
GACGGTCGTCGCCGACGACGGGGACATGGCGCTGGGCCATGCACTGACCGGCGCGTTCGACCTGATGCTGCTGGACATCG
GCCTGCCGGGGCGGGACGGCTTCACCGTCCTGCGTGAGCTGCGCGAGGCGCGGGTCACCCTGCCGGTCATCGTGCTCACC
GCCCGGGACTCCGTCCGGGACACGGTGGCGGGGCTGGAGGGCGGGGCCGACGACTGGATGACGAAGCCGTTCCGGTTCGA
GGAACTGCTCGCCCGGGTACGGCTGCGCCAACGCACGGCCGGACGCGCCCCCGAGGTGACCCTGTTGCGCAGCGGCAGCC
TCGCCCTGGACCTGCGGACGCGGCGGGCCCGCGCCGACGAGCGGACGGTGGACCTGACGGCACGGGAGTTCGTGCTGCTT
GAGATGTTCCTGCGCCACCCCGGGCAGGTCCTCTCGCGCGAGCAGATCCTCTCCCATGTGTGGGGGTACGACTTCGACCC
GGGCTCCAACATCGTGGACGTGTACGTCCGTGCGCTGCGCCGGAAGCTGGGGGCGGAGCGGCTGGAGACGGTACGGGGGA
TGGGGTACCGGCTGCCCTGA

Protein sequence :
MNRILIAEDEERIASFVQKGLRANGFTTVVADDGDMALGHALTGAFDLMLLDIGLPGRDGFTVLRELREARVTLPVIVLT
ARDSVRDTVAGLEGGADDWMTKPFRFEELLARVRLRQRTAGRAPEVTLLRSGSLALDLRTRRARADERTVDLTAREFVLL
EMFLRHPGQVLSREQILSHVWGYDFDPGSNIVDVYVRALRRKLGAERLETVRGMGYRLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 3e-33 48
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 9e-34 46
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0638 Protein 3e-30 46
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0083 Protein 1e-35 45
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-28 44
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 9e-34 43
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0111 Protein 3e-34 42
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family BAC0347 Protein 6e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 3e-31 47
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 2e-32 45
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 2e-32 44
SFUL_5317 YP_007934095.1 Two component transcriptional regulator, winged helix family VFG1386 Protein 2e-31 41