Gene Information

Name : SFUL_5199 (SFUL_5199)
Accession : YP_007933977.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5745009 - 5745671 bp
Length : 663 bp
Strand : +
Note : UniProt-pubmed:20624727; UniProt-pubmed:20581206; UniProt-pubmed:18375553; UniProt-pubmed:12000953; gene_name:czcR; UniProt-pubmed:20064060; UniProt-pubmed:21551298

DNA sequence :
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGTCTCGCGGTGTCCCTCGCCCGGGGACTCACCGCCGAGGGCTTCGCCGT
GGATGTCGTGCACGACGGCCTCGAGGGGCTGCACCGGGCGAGCGAGGGCGGCTACGACCTGGTGATCCTCGACATCATGC
TGCCCGGCATGAACGGCTACCGGGTCTGCGGTGCCCTGCGCGCCGCCGGACACGAGGTGCCGATCCTCATGCTGACCGCC
AAGGACGGCGAGTACGACGAGGCCGAGGGGCTCGACACCGGCGCGGACGACTACCTGACCAAGCCCTTCAGCTACGTCGT
CCTCGTCGCCCGGGTCCGCGCCCTGCTGCGCCGGCGTGGGGCCGGCACCGCCGCGCCCGTCCTGACCATCGGCACCCTTC
GCATCGACACCGCCGCCCGACGCGTCCACCGCGGTGAGGACGAGTACGCCCTCACCGCCAAGGAGTTCGCGGTGCTGGAG
CAACTCGCCCTGCGCGCCGGGCACGTGGTCAGCAAGGCCGAGATCCTGGAGCACGTCTGGGACTTCGCCTACGACGGCGA
CCCGAACATCGTCGAGGTCTACATCTCCACCCTCCGCCGCAAGCTGGGCGCCGCCTCCATCGTGACGGTGCGTGGCGCCG
GCTACCGGCTGGAGGCGGGATGA

Protein sequence :
MRLLIVEDEKRLAVSLARGLTAEGFAVDVVHDGLEGLHRASEGGYDLVILDIMLPGMNGYRVCGALRAAGHEVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVRALLRRRGAGTAAPVLTIGTLRIDTAARRVHRGEDEYALTAKEFAVLE
QLALRAGHVVSKAEILEHVWDFAYDGDPNIVEVYISTLRRKLGAASIVTVRGAGYRLEAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0083 Protein 3e-37 48
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0197 Protein 6e-34 46
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0125 Protein 4e-35 45
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0111 Protein 6e-36 45
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0638 Protein 2e-31 45
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0308 Protein 2e-34 44
SFUL_5199 YP_007933977.1 two-component system response regulator U82965.2.orf14.gene. Protein 8e-25 44
SFUL_5199 YP_007933977.1 two-component system response regulator Y16952.3.orf35.gene. Protein 1e-24 43
SFUL_5199 YP_007933977.1 two-component system response regulator BAC0347 Protein 3e-30 42
SFUL_5199 YP_007933977.1 two-component system response regulator NC_002516.2.879194.p Protein 1e-21 42
SFUL_5199 YP_007933977.1 two-component system response regulator FJ349556.1.orf0.gene Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_5199 YP_007933977.1 two-component system response regulator VFG0596 Protein 3e-33 44
SFUL_5199 YP_007933977.1 two-component system response regulator VFG1390 Protein 6e-36 43
SFUL_5199 YP_007933977.1 two-component system response regulator VFG1386 Protein 7e-30 42
SFUL_5199 YP_007933977.1 two-component system response regulator VFG1389 Protein 2e-29 42