Gene Information

Name : SFUL_4080 (SFUL_4080)
Accession : YP_007932866.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : Stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4548389 - 4548964 bp
Length : 576 bp
Strand : -
Note : UniProt-pubmed:11572948; gene_name:terD2; UniProt-pubmed:18375553; UniProt-pubmed:20581206; UniProt-pubmed:12000953; UniProt-pubmed:20064060; UniProt-pubmed:21551298; tellurium resistance protein

DNA sequence : 
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCCCCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGCGGTCACCCCGGCGGGGAAGG
TCGTCTCCGACGGCCACTTCGTCTTCTTCAACAACAAGTCGACGCCGGACCAGACCATCGTGCACACCGGTGACAACGTC
ACGGGTGAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCGGGTCTCCCGGCCGACGTGGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCAGCCAGAACTTCGGCCAGGTCCGGAACGCGTTCATCCGCATCCTCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGTGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGTTACGCCTCCGGCCTCAGCGGCATCGCCCGCGACTT
CGGCGTCAACCTCTGA

Protein sequence : 
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVTPAGKVVSDGHFVFFNNKSTPDQTIVHTGDNV
TGEGEGDDEQINVNLAGLPADVDKIVFPVSIYDAENRSQNFGQVRNAFIRILNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLSGIARDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-60 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-58 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_4080 YP_007932866.1 Stress protein BAC0390 Protein 8e-59 62
SFUL_4080 YP_007932866.1 Stress protein BAC0389 Protein 5e-57 59