Gene Information

Name : SFUL_3754 (SFUL_3754)
Accession : YP_007932557.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : Two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4207694 - 4208440 bp
Length : 747 bp
Strand : +
Note : UniProt-pubmed:11572948; UniProt-pubmed:20624727; UniProt-pubmed:21463507; UniProt-pubmed:18375553; UniProt-pubmed:20581206; UniProt-pubmed:12000953; two component system response regulator; UniProt-pubmed:20064060; UniProt-pubmed:21551298

DNA sequence :
ATGACGACGACGACCGCGCCCCAGGGGCGTACCGAACTGCTCAGGCCGGACCGTACGCCCGTGCGCGTCCTGGTCGTGGA
CGACGAGGCTCCGCTCGCCGAGCTGCTCTCGATGGCCCTGCGGTACGAGGGCTGGGAGGTGCGCAGCGCCGGTGACGGGG
CCGGGGCCGTGCGCGCCGCCCGGGACTTCCGCCCGGACGCCGTGGTCCTCGACGTGATGCTCCCGGACATGGACGGGCTC
GCCGTGCTGGGCCGGATCCGGCGCGAGTACTCCGATGTGCCCGTCCTCTTCCTGACCGCCCGGGACGCCGTGGAGGACCG
GATCGCCGGGCTCACGGCGGGCGGCGACGACTACGTGACCAAGCCGTTCAGCCTGGAGGAGGTCGTGGCCCGGCTGCGCG
GGCTGATCCGCCGGTCCGGTACGGCGCTCGCGGCCGAGCGGAGCCAGTCGACGCTCACCGTCGGCGACCTGGTGCTCGAC
GAGGACAGCCACGAGGTGAGCCGGGGCGGGAACGCGATCCACCTGACCGCCACGGAGTTCGAGCTGCTGCGGTTCCTGAT
GCGCAACCCGCGACGGGTGCTCAGCAAGGCGCAGATCCTGGACCGGGTCTGGAACTACGACTTCGGCGGCCAGGCCAACG
TCGTGGAGCTCTACATCTCCTACCTCCGCAAGAAGATCGACGCCGGACGGACGCCGATGATCCACACCCGGCGCGGGGCG
GGGTATCTGATCAAGCCCGGTGAGTAG

Protein sequence :
MTTTTAPQGRTELLRPDRTPVRVLVVDDEAPLAELLSMALRYEGWEVRSAGDGAGAVRAARDFRPDAVVLDVMLPDMDGL
AVLGRIRREYSDVPVLFLTARDAVEDRIAGLTAGGDDYVTKPFSLEEVVARLRGLIRRSGTALAAERSQSTLTVGDLVLD
EDSHEVSRGGNAIHLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQANVVELYISYLRKKIDAGRTPMIHTRRGA
GYLIKPGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-23 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-23 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_3754 YP_007932557.1 Two-component system response regulator BAC0197 Protein 6e-34 48
SFUL_3754 YP_007932557.1 Two-component system response regulator BAC0083 Protein 1e-34 47
SFUL_3754 YP_007932557.1 Two-component system response regulator BAC0638 Protein 6e-28 45
SFUL_3754 YP_007932557.1 Two-component system response regulator HE999704.1.gene2815. Protein 2e-35 44
SFUL_3754 YP_007932557.1 Two-component system response regulator BAC0125 Protein 5e-30 42
SFUL_3754 YP_007932557.1 Two-component system response regulator AE016830.1.gene1681. Protein 7e-38 42
SFUL_3754 YP_007932557.1 Two-component system response regulator BAC0487 Protein 2e-23 42
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_002952.2859905.p0 Protein 1e-33 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_002745.1124361.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_009782.5559369.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_002951.3237708.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_003923.1003749.p0 Protein 7e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_002758.1121668.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_009641.5332272.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_013450.8614421.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_007793.3914279.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator NC_007622.3794472.p0 Protein 9e-34 41
SFUL_3754 YP_007932557.1 Two-component system response regulator AF310956.2.orf0.gene Protein 5e-24 41
SFUL_3754 YP_007932557.1 Two-component system response regulator AE016830.1.gene2255. Protein 1e-23 41
SFUL_3754 YP_007932557.1 Two-component system response regulator U35369.1.gene1.p01 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_3754 YP_007932557.1 Two-component system response regulator VFG1386 Protein 3e-56 59
SFUL_3754 YP_007932557.1 Two-component system response regulator VFG1390 Protein 3e-44 48
SFUL_3754 YP_007932557.1 Two-component system response regulator VFG1389 Protein 1e-38 47
SFUL_3754 YP_007932557.1 Two-component system response regulator VFG0596 Protein 2e-26 41