Gene Information

Name : SFUL_2892 (SFUL_2892)
Accession : YP_007931716.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3283153 - 3283839 bp
Length : 687 bp
Strand : +
Note : gene_name:amrE; gene_name:phoB; two-component system response regulator; UniProt-pubmed:18218977; gene_name:mtrA; UniProt-pubmed:20567260; gene_name:phoP; UniProt-pubmed:17151343; gene_name:OmpR

DNA sequence :
ATGACACCGAGCAAGGGCCTGGTCCTGGTCGTGGAGGACGAGCGCCACATCGCCGACCTCCAGCGCCTCTACCTCACCCG
CGAGGGCTTCGGTGTCCACACCGAGGGCGACGGGGCGGCCGGCCTCGCAGCGGTCCGGCGGCTGCGGCCGGTGGCGGTCG
TCCTCGACATCGGCCTGCCCGGTCTGGACGGCACCGAGTTCTGCCGCCGCCTGCGCGCCGCCGACGACTGGACGCCGGTG
ATCCTGGTCACCGCGCGCGACGAGGAAGCCGACCGGATCCTCGGCCTGGAGCTCGGCGCGGACGACTACGTCACCAAACC
GTTCTCGCCGCGTGAACTGGTCGCCCGCGTCAAGGCGGTCCTGCGCCGGAGCGCCGGACCGCAGACCGCCGGTGTGCGGA
GCGTCGGGCGCCTGCGGCTGGACCCGCTGCGCCGCACCGTGCACCGCGACGGCGAGCCGGTGGAGCTGACCACCACCGAG
TTCAACCTGCTCGCCCACCTGCTGGCCCGGCCGGGCCAGGTCTTCGGCCGCGACCAGCTGCTCTCCCAGGTGTGGGGGTA
CGCGGACTACCGCGACAGCCGGGTCGTCGACGTCTACGTCTCCCAGCTGCGCGCCAAACTCGGCGACGCCAGCCCGATCC
GCACCGTGCGTGGCGTCGGCTACAGCGCGCGGGAGAGCAGCCGGTGA

Protein sequence :
MTPSKGLVLVVEDERHIADLQRLYLTREGFGVHTEGDGAAGLAAVRRLRPVAVVLDIGLPGLDGTEFCRRLRAADDWTPV
ILVTARDEEADRILGLELGADDYVTKPFSPRELVARVKAVLRRSAGPQTAGVRSVGRLRLDPLRRTVHRDGEPVELTTTE
FNLLAHLLARPGQVFGRDQLLSQVWGYADYRDSRVVDVYVSQLRAKLGDASPIRTVRGVGYSARESSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-21 42
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 5e-25 48
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-27 47
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 2e-23 45
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0083 Protein 1e-27 45
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-35 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-34 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 9e-21 44
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-31 43
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-30 42
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 2e-24 42
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-29 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 8e-26 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 8e-26 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 6e-26 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 7e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 3e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0596 Protein 3e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 8e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family BAC0039 Protein 8e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 3e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 8e-25 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 1e-19 41
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 7e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 1e-23 46
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family VFG1386 Protein 2e-26 43
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 1e-29 42
SFUL_2892 YP_007931716.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 2e-21 42