Gene Information

Name : SFUL_2607 (SFUL_2607)
Accession : YP_007931439.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2960321 - 2961010 bp
Length : 690 bp
Strand : -
Note : UniProt-pubmed:11572948; UniProt-pubmed:20624727; Two-component system response regulator; UniProt-pubmed:18375553; gene_name:scrA; UniProt-pubmed:21463507; UniProt-pubmed:20064060; UniProt-pubmed:12000953; UniProt-pubmed:21551298; gene_name:mtrA

DNA sequence :
ATGATGTCGATTATGAAGGGACGCGTCCTTGTCGTCGACGACGACACCGCACTGGCCGAGATGCTCGGGATTGTGCTGCG
TGGAGAAGGTTTCGAGCCGTCGTTCGTAGCGGACGGCGACAAGGCACTGGCCGCATTTCGTGAGGCCAAGCCGGACCTGG
TGCTGCTCGACCTCATGCTGCCCGGAAGGGACGGCATCGAGGTGTGCAGGCTGATCAGGGCCGAGTCCGGTGTGCCGATC
GTCATGCTCACTGCCAAGAGCGACACCGTCGATGTCGTGGTCGGCCTGGAATCAGGGGCCGACGACTACATCGTCAAGCC
GTTCAAACCTAAGGAGTTGGTCGCCCGGATCAGGGCACGCCTGCGGCGGTCCGAAGAGCCCGCGCCGGAGCAGTTGACCA
TCGGTGACCTGGTCATCGACGTGGCCGGTCACTCCGTGAAGCGGGAGGGGCAGTCCATCGCCCTGACGCCGCTGGAGTTC
GACCTGCTGGTCGCCCTCGCCCGCAAGCCGTGGCAGGTCTTCACCCGTGAGGTCCTGCTGGAGCAGGTCTGGGGCTACCG
GCACGCGGCCGACACCCGGCTGGTGAACGTGCATGTCCAGCGGCTGCGCTCCAAGGTCGAGAAGGACCCGGAGCGGCCGG
AGATCGTTGTGACCGTCCGAGGGGTCGGTTACAAGGCCGGACCGAGCTGA

Protein sequence :
MMSIMKGRVLVVDDDTALAEMLGIVLRGEGFEPSFVADGDKALAAFREAKPDLVLLDLMLPGRDGIEVCRLIRAESGVPI
VMLTAKSDTVDVVVGLESGADDYIVKPFKPKELVARIRARLRRSEEPAPEQLTIGDLVIDVAGHSVKREGQSIALTPLEF
DLLVALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPERPEIVVTVRGVGYKAGPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-80 75
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 6e-34 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-46 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-45 46
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-42 45
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-42 44
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-36 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 3e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family BAC0596 Protein 3e-40 43
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-41 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-39 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-40 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 2e-40 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family BAC0039 Protein 2e-40 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-34 41
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-35 41
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-36 41
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 4e-32 41
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 5e-37 41
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 6e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 4e-32 45
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 2e-35 42
SFUL_2607 YP_007931439.1 Two component transcriptional regulator, winged helix family VFG1702 Protein 3e-38 41