Gene Information

Name : SFUL_1949 (SFUL_1949)
Accession : YP_007930797.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : Putative TerD-family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2193823 - 2194398 bp
Length : 576 bp
Strand : -
Note : UniProt-pubmed:11572948; UniProt-pubmed:20624727; gene_name:terD3; gene_name:terD; UniProt-pubmed:18375553; gene_name:yceD; gene_name:terD4; UniProt-pubmed:20064060; UniProt-pubmed:21551298; UniProt-pubmed:20581206; Uncharacterized proteins involved in st

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGCTGACCAAGGCCGCGCCCAACCTGACCGCGGTCATCGTCGGTCT
GGGCTGGGACGCCCGCACCACCACCGGCGGCGACTTCGACCTCGACGCCAGCGCGCTGCTGGCGAACGCCGAGGGCAAGG
TCGCGGCGGACGGCAATTTCGTCTTCTTCAACAACCTGAAGAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAAGGTGAACCTCGCCGGTGTCCCGGCCGATGTCGACAAGATCGTCTT
CCCGGTCTCGATCTACGAGGCCGAGAGCCGCCAGCAGAGCTTCGGCCAGGTCCGCAACGCGTACATCCGCGTGGTGAACC
AGGCCGACAACACCGAGCTCGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGCAACGGTGCCGAGTGGAAGTTCCGTGCCATCGGCCAGGGCTACGCCTCGGGCCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVIVGLGWDARTTTGGDFDLDASALLANAEGKVAADGNFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVIKVNLAGVPADVDKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADNTELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-61 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-62 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-58 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-29 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_1949 YP_007930797.1 Putative TerD-family protein BAC0389 Protein 8e-62 66
SFUL_1949 YP_007930797.1 Putative TerD-family protein BAC0390 Protein 7e-59 62
SFUL_1949 YP_007930797.1 Putative TerD-family protein BAC0392 Protein 2e-28 43