Gene Information

Name : SFUL_1948 (SFUL_1948)
Accession : YP_007930796.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : Stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2193057 - 2193632 bp
Length : 576 bp
Strand : -
Note : UniProt-pubmed:11572948; UniProt-pubmed:21463507; gene_name:terD4; UniProt-pubmed:12000953; UniProt-pubmed:20064060; UniProt-pubmed:18375553

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAATGTCTCCCTCTCCAAGGTCGCACCCAACCTCACCCAGGTGCTGGTCGGGCT
CGGCTGGGACGCACGCTCCACCACCGGAGCAGATTTCGACCTCGACGCCAGCGCACTGCTGTGCCAGTCGGGCCGGGTGC
TCGGTGACGAGTGGTTCGTCTTCTACAACAACCTCACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAATCTGACC
GGTGAGGGCGACGGCGACGACGAGTCGGTCATCGTCCGGCTCGACCAGGTCCCCGCCCACTGCGACAAGATCGTCTTCCC
GGTCTCCATCCATGACGCGGACAACCGGGGCCAGGCGTTCGGGCAGGTCAGCAACGCCTTCATCCGCGTGGTGAACCAGG
CCGACGGCCAGGAGCTGGCGCGCTACGACCTCAGCGAGGACGCCTCCACGGAGACCGCGATGATCTTCGGTGAGCTCTAC
CGCTACCAGGGCGAGTGGAAATTCCGTGCAGTCGGTCAGGGGTACGCGTCGGGCTTGCGGGGCATCGCTCTAGACTTCGG
CGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKVAPNLTQVLVGLGWDARSTTGADFDLDASALLCQSGRVLGDEWFVFYNNLTSPDGSVEHTGDNLT
GEGDGDDESVIVRLDQVPAHCDKIVFPVSIHDADNRGQAFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELY
RYQGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-58 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-56 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 62
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_1948 YP_007930796.1 Stress protein BAC0389 Protein 5e-58 68
SFUL_1948 YP_007930796.1 Stress protein BAC0390 Protein 2e-56 64
SFUL_1948 YP_007930796.1 Stress protein BAC0392 Protein 9e-25 42