Gene Information

Name : I872_05425 (I872_05425)
Accession : YP_007923327.1
Strain : Streptococcus oligofermentans AS 1.3089
Genome accession: NC_021175
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein terD,TerD family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1082988 - 1083626 bp
Length : 639 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTATTAATTTCACCTCACTTGGCGGACCTGCCAACCCTACTCCAACACCCACTGAAGTTGCTCCTACAACGGGAGG
TGTATCTCTTGATTTAGAAAAAAATACTATCCTGGACTTAGCTAAAGCTGCTCCAGGCCTTACAAAAGTTGACTTATGCG
CTGGTTGGGATATCTCTGCCGGCGGTGCCGATTTTGACCTTGATATTTCTGCTTTCCTATTAAATGAAGCAGGTAAAATT
ACTTCTGCTAGTGATGTCATTTTTTATAATAACAAAACTGCTCCTGGGATTTACTTAAATGGTGATAACCGTACGGGTGC
AGGAGATGGTGATGATGAAGTTATCAGTTTGGATTTAGCTACTCTCTCACCAAGTATCCATAAAATCATTTGTGCTATTA
CCATCGATCAGGCTATCGCCCGCCGCCAAACTTTCGGCATGGTTAATAATTCCTATGTTCGCTTAGTTAATGTCGAGAAC
AATTCTGAACTTTGTAAATTCCAGCTGAAAGATGATTATTCGACCGATACAGCTGTTGTCTTTGCAGAACTCGTAAGAGA
TGGTTCAACTTGGGCTTTCCACACCATCGGTGAAGGAAAACAGGCTGATTTAAATGGTATAGCTGCACTCTTTAGCTAA

Protein sequence :
MAINFTSLGGPANPTPTPTEVAPTTGGVSLDLEKNTILDLAKAAPGLTKVDLCAGWDISAGGADFDLDISAFLLNEAGKI
TSASDVIFYNNKTAPGIYLNGDNRTGAGDGDDEVISLDLATLSPSIHKIICAITIDQAIARRQTFGMVNNSYVRLVNVEN
NSELCKFQLKDDYSTDTAVVFAELVRDGSTWAFHTIGEGKQADLNGIAALFS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-38 47
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-35 44
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-36 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-36 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-34 44
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 44
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 44
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I872_05425 YP_007923327.1 Tellurium resistance protein terD,TerD family BAC0389 Protein 3e-35 44
I872_05425 YP_007923327.1 Tellurium resistance protein terD,TerD family BAC0390 Protein 3e-36 44