Gene Information

Name : B1NLA3E_14280 (B1NLA3E_14280)
Accession : YP_007911101.1
Strain : Bacillus sp. 1NLA3E
Genome accession: NC_021171
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3122449 - 3123030 bp
Length : 582 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence : 
ATGGCAATCAGTCTTTCAAAAGGTCAAAAAGTGGATTTAACAAAAACCAATCCTGGATTAACAAATGTAGTAGTTGGTCT
TGGCTGGGATACCAATAAATACGATGGAGGAAAAGATTTTGACCTCGATTCTTCTGTTTTTTTACTAGGTGAAAATGGGA
AGGTTCCATCAGAAAACGACTTTGTATTTTATAATAATACAAAAGGTGGAAATGGCTCAGTTGTACATACTGGAGATAAC
CGCACAGGAGCCGGAGATGGTGATGATGAAGCGGTTGAGATCAATTTAACAAATGTTCCAGCCAATATTCATCGGATTAC
TTTTACAATAACCATCCATGATGCAGAAGCACGCAATCAAAACTTCGGTCAAGTTTCTAATGCATACGTTAGAATCTTCA
ATCCTGCTTCTAATCAAGAATTAATCCGTTTTGATCTTGGTGAGGATTTCTCGATTGAAACAGCGTTAGTTGTTGGGGAA
CTGTATCGGCATAATGGAGAATGGAAATTTAGCGCAATTGGAAGTGGCTATCAAGGTGGCTTAGCTGCATTAGCTACAGA
TTTTGGTTTACAAGTTGGTTAA

Protein sequence : 
MAISLSKGQKVDLTKTNPGLTNVVVGLGWDTNKYDGGKDFDLDSSVFLLGENGKVPSENDFVFYNNTKGGNGSVVHTGDN
RTGAGDGDDEAVEINLTNVPANIHRITFTITIHDAEARNQNFGQVSNAYVRIFNPASNQELIRFDLGEDFSIETALVVGE
LYRHNGEWKFSAIGSGYQGGLAALATDFGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-56 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-52 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-54 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-51 56
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_14280 YP_007911101.1 tellurium resistance protein TerD BAC0390 Protein 4e-54 58
B1NLA3E_14280 YP_007911101.1 tellurium resistance protein TerD BAC0389 Protein 3e-55 57