Gene Information

Name : B1NLA3E_14240 (B1NLA3E_14240)
Accession : YP_007911093.1
Strain : Bacillus sp. 1NLA3E
Genome accession: NC_021171
Putative virulence/resistance : Resistance
Product : tellurium resistance protein terE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3113223 - 3113837 bp
Length : 615 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTAGTTTACAAAAAGGACAACGTGTGGACTTAACTAAAGGAAATCCTGGTCTTTCTAAGATATTAGTTGGATT
AGGATGGGATCCCGTGGAAACAAAAGGAAGCGGAGGTTTATTCGGAGGCTTATTCGGAGGTGGATCCAGTAGTGTAAATA
TTGATTGTGATGCATCAGTTATTATGCTTGGTGAGCAAGATAAACTTCAAAATAAAAATGATGTCATTTACTTTGGTAAT
TTAAAAAGTGGAGACGGTAGCGTTCATCATTCCGGTGATAATTTAACAGGCCAAGGTGATGGTGACGATGAGCAAATCGT
CATTGAACTAAATCGAATTCCTGCTAAAATTCAAAAATTGGTATTTGTCGTAAATATATATGACAGTGTAAAAAGAAAGC
AACATTTTGGGATGATTAAAAATGCTTTCATCCGTGTTGTAAATTCAAGTAATAACCAAGAAATGATTAAATATAATCTA
ACGGACGATTATAATGGAAAAACAAGCCTTGTGGTTGGAGAAATTTATCGCAATGGTAGTGATTGGAAATTCGCGGCTGT
TGGTACAGGAACCAATGCAGCAGGATTGTCTGAAGTAGTTCGTTCATATTCATAA

Protein sequence :
MAISLQKGQRVDLTKGNPGLSKILVGLGWDPVETKGSGGLFGGLFGGGSSSVNIDCDASVIMLGEQDKLQNKNDVIYFGN
LKSGDGSVHHSGDNLTGQGDGDDEQIVIELNRIPAKIQKLVFVVNIYDSVKRKQHFGMIKNAFIRVVNSSNNQEMIKYNL
TDDYNGKTSLVVGEIYRNGSDWKFAAVGTGTNAAGLSEVVRSYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-38 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-37 46
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-37 46
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-41 45
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-34 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-38 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-38 43
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-38 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_14240 YP_007911093.1 tellurium resistance protein terE BAC0389 Protein 2e-38 44
B1NLA3E_14240 YP_007911093.1 tellurium resistance protein terE BAC0390 Protein 1e-38 44