Gene Information

Name : B1NLA3E_10565 (B1NLA3E_10565)
Accession : YP_007910370.1
Strain : Bacillus sp. 1NLA3E
Genome accession: NC_021171
Putative virulence/resistance : Virulence
Product : two-component response regulator YclJ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2317096 - 2317806 bp
Length : 711 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAACATTCTGATGATAGAGGATAATGAAAGTGTTTGTTCAATGGTTGAGATGTTCTTTTTAAAGGAAGGCATTAATGG
GGAGTTTGTTAATGACGGACTAGAAGGATATCAACGGTTTCAAAGTGGTGAATGGGATTTATTAATTATCGACTGGATGC
TACCTAATATGGATGGCGTGACAATTTGCAGAAAAATACGTGAGGAAAATAAAACGATCCCGATTATTATGCTAACAGCT
AAAGATACAGAGTCTGATCAAGTTCTAGGGCTTGAAATGGGTGCGGATGACTATGTTACAAAGCCTTTCAGCCCATTAGC
TTTAATGGCTAGGATTAAAGCTGTTTCAAGACGTTCAACTATTGCTGGGAAAGAAGAAGAGGCAAATAGAACTCATTTTA
TCGAAACACAATTGTTTAAAATAAGTAAAGATACTCGTGAAGTATTATTGAAGGGTAAGCCCATTACCAACCTCACTCCA
AAGGAATTTGATTTACTTTATTATTTTATCGAACATCCCCGTCAGGTTTTTTCAAGAGAGCAATTATTAGAACGGGTTTG
GGGCTATCAATATTATGGAGATGAACGGACTGTAGATGTTCATATTAAGCGGTTGCGAAACAAGATTGGGACGCCCAATC
AGCCATTTTTACAAACGGTTTGGGGAGTAGGCTATAAATTTGATGAATCGGTGGTAGAAGATGAGGCTTAA

Protein sequence :
MNILMIEDNESVCSMVEMFFLKEGINGEFVNDGLEGYQRFQSGEWDLLIIDWMLPNMDGVTICRKIREENKTIPIIMLTA
KDTESDQVLGLEMGADDYVTKPFSPLALMARIKAVSRRSTIAGKEEEANRTHFIETQLFKISKDTREVLLKGKPITNLTP
KEFDLLYYFIEHPRQVFSREQLLERVWGYQYYGDERTVDVHIKRLRNKIGTPNQPFLQTVWGVGYKFDESVVEDEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_012469.1.7685629. Protein 2e-39 43
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ AE016830.1.gene1681. Protein 3e-42 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_002952.2859905.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ HE999704.1.gene2815. Protein 1e-43 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_003923.1003749.p0 Protein 1e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_002758.1121668.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_009641.5332272.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_013450.8614421.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_007793.3914279.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_007622.3794472.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_002745.1124361.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_009782.5559369.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_002951.3237708.p0 Protein 2e-40 42
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_010410.6002989.p0 Protein 6e-37 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_010400.5986590.p0 Protein 1e-36 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_011595.7057856.p0 Protein 6e-37 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ AF155139.2.orf0.gene Protein 3e-37 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_014475.1.orf0.gen Protein 2e-34 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ AF130997.1.orf0.gene Protein 1e-32 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_005054.2598277.p0 Protein 2e-34 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ FJ349556.1.orf0.gene Protein 4e-39 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ NC_012469.1.7686381. Protein 2e-42 41
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ AM180355.1.gene1830. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ VFG1563 Protein 1e-37 43
B1NLA3E_10565 YP_007910370.1 two-component response regulator YclJ VFG1702 Protein 8e-38 43