Gene Information

Name : STU288_1p00735 (STU288_1p00735)
Accession : YP_007905881.1
Strain :
Genome accession: NC_021155
Putative virulence/resistance : Resistance
Product : QacEdelta1 protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 104721 - 105053 bp
Length : 333 bp
Strand : -
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
GTGAAGAACTGGCTCTTTCTGGCTATTGCAATATTTGGTGAGGTCGTCGCAACTTCCGCACTGAAGTCCAGCCATGGATT
CACCAAGTTAGTTCCTTCTGTTGTAGTTGTGGCTGGCTACGGGCTTGCGTTCTATTTCCTCTCTCTCGCACTCAAGTCCA
TCCCGGTCGGCATTGCTTATGCTGTTTGGGCTGGCCTCGGCATCGTACTTGTGGCAGCTATCGCTTGGATCTTCCATGGC
CAGAAACTAGACTTGTGGGCGTTCGTTGGCATGGGACTTATCGTTAGTGGCGTCGCCGTTCTAAATCTGCTATCCAAGGT
CAGCGCACATTGA

Protein sequence :
MKNWLFLAIAIFGEVVATSALKSSHGFTKLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHG
QKLDLWAFVGMGLIVSGVAVLNLLSKVSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-32 76
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-31 76
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-31 76
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-32 76
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-32 76
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-32 76
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-32 76
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-32 76
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-32 76
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-32 76
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-31 76
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-32 76
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-31 76
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-32 76
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-32 76
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-32 76
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-31 76
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 43
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0324 Protein 1e-42 94
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0322 Protein 5e-37 80
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0323 Protein 4e-32 76
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0377 Protein 1e-19 57
STU288_1p00735 YP_007905881.1 QacEdelta1 protein NC_010410.6003348.p0 Protein 6e-26 57
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0002 Protein 6e-26 57
STU288_1p00735 YP_007905881.1 QacEdelta1 protein CP004022.1.gene1549. Protein 7e-21 54
STU288_1p00735 YP_007905881.1 QacEdelta1 protein CP001138.1.gene1489. Protein 2e-22 54
STU288_1p00735 YP_007905881.1 QacEdelta1 protein NC_002695.1.913273.p Protein 8e-19 49
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0150 Protein 6e-19 48
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0192 Protein 1e-14 47
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0139 Protein 4e-14 46
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0140 Protein 6e-13 44
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0329 Protein 1e-13 44
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0249 Protein 2e-09 43
STU288_1p00735 YP_007905881.1 QacEdelta1 protein AE000516.2.gene3301. Protein 2e-09 43
STU288_1p00735 YP_007905881.1 QacEdelta1 protein BAC0326 Protein 4e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STU288_1p00735 YP_007905881.1 QacEdelta1 protein VFG1586 Protein 5e-13 43
STU288_1p00735 YP_007905881.1 QacEdelta1 protein VFG1587 Protein 4e-14 42