Name : ureB (AvCA_09890) Accession : YP_007892008.1 Strain : Azotobacter vinelandii CA Genome accession: NC_021149 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : - COG ID : - EC number : - Position : 940757 - 941062 bp Length : 306 bp Strand : - Note : 'ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzy DNA sequence : ATGATCCCCGGCGAATACCAGATCCAGGACGGCGAGATCGAACTCAACGCCGGCCGCCGCACGCTGACCCTGAACGTGGC CAACAGCGGCGACCGGCCGATCCAGGTCGGCTCGCACTACCACTTCTTCGAGACCAACGACGCCCTCGTCTTCGACCGCG CCCTGGCCCGCGGCATGCGCCTGAACATCCCGGCCGGCACCGCAGTGCGCTTCGAGCCGGGGCAGAGCCGCGAGGTCGAG CTGGTCGAGCTGGCCGGCCTGCGCCGCGTCTACGGCTTCGCCGGGCGGGTGATGGGCGAACTGTAG Protein sequence : MIPGEYQIQDGEIELNAGRRTLTLNVANSGDRPIQVGSHYHFFETNDALVFDRALARGMRLNIPAGTAVRFEPGQSREVE LVELAGLRRVYGFAGRVMGEL |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 1e-26 | 71 |
ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 1e-26 | 71 |
ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 9e-25 | 61 |
ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 6e-25 | 61 |
ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 6e-25 | 61 |
ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 6e-25 | 61 |