Gene Information

Name : rpmG (AvCA_48040)
Accession : YP_007895692.1
Strain : Azotobacter vinelandii CA
Genome accession: NC_021149
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L33
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4870179 - 4870334 bp
Length : 156 bp
Strand : -
Note : 'in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of t

DNA sequence :
ATGCGTGAACTGATCCGTCTGGTGTCCAGCGCCGGTACCGGCCACTTCTACACCACCGACAAGAACAAGCGCACCACCCC
CGACAAGATCGAGATCAAGAAATACGATCCCGTTGTGCGCAAGCATGTGATCTACAAGGAAGCCAAGATCAAGTGA

Protein sequence :
MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKYDPVVRKHVIYKEAKIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmG NP_814353.1 50S ribosomal protein L33 Not tested Not named Protein 7e-07 45
ef0106 AAM75309.1 EF0106 Not tested Not named Protein 5e-07 45