Gene Information

Name : AvCA_15530 (AvCA_15530)
Accession : YP_007892553.1
Strain : Azotobacter vinelandii CA
Genome accession: NC_021149
Putative virulence/resistance : Virulence
Product : heavy metal response regulator, two-component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1526789 - 1527472 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTGCTGATCGTCGAAGACGAACCCAAGACCGGCCGCGCCCTGCTGCAGGGACTCGGCGAGGCCGGCTTCGCCGT
CGATCTGGCCGTCGACGGCACGAGCGGCGAACGCCTGGCGCTGGCGGGCAAGTACGATCTGCTGATCCTCGACGTGATGC
TGCCCGAGCGCGACGGCTGGCAGATCCTGAACGCTGTGCGCCAGGCGGGCCTGGAGACGCCGGTGCTGTTTCTCACCGCC
CGCGATGCGGTGGCGGACCGGGTGCGCGGCCTGGAGCTGGGCGCCGACGACTACCTGGTCAAGCCCTTCGCTTTCGCCGA
GTTGCTGGCGCGGGTGCGCAGCCTGTTGCGCCGCGGGCAGGTCTCGGCCCCGGAAACCCGCCTGCAGGCCGCCGACCTGG
AACTCGATCTGTTGCGCCGGAGGGTCCGCCGCAACGGCCGGCGCATCGAGCTGGCGCCCAGGGAATTCGCCCTGCTCGAG
CTGCTGCTACGCCGCCAGGGCGAGGTGCTGCCCAAGTCGCTGATCGCCGCCGAGGTCTGGAACATGCACTTCGACAGCGG
GACCAACGTCGTGGAAGTGGCCGTCCGCCGCCTGCGCGCGAAGATCGACGACGGCTTCGTGCCGCCGCTGATCCATACGG
TGCGCGGCCTGGGCTATGTCCTCGAGGTGCGCGAGGCGCCATGA

Protein sequence :
MKLLIVEDEPKTGRALLQGLGEAGFAVDLAVDGTSGERLALAGKYDLLILDVMLPERDGWQILNAVRQAGLETPVLFLTA
RDAVADRVRGLELGADDYLVKPFAFAELLARVRSLLRRGQVSAPETRLQAADLELDLLRRRVRRNGRRIELAPREFALLE
LLLRRQGEVLPKSLIAAEVWNMHFDSGTNVVEVAVRRLRAKIDDGFVPPLIHTVRGLGYVLEVREAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-40 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-39 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0083 Protein 5e-51 66
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0638 Protein 2e-52 65
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0308 Protein 1e-50 63
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0197 Protein 1e-49 63
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0111 Protein 6e-52 62
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0347 Protein 2e-44 58
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0125 Protein 2e-45 54
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component BAC0487 Protein 3e-22 42
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_002952.2859905.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_013450.8614421.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_007793.3914279.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_007622.3794472.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_002745.1124361.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_009782.5559369.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_002951.3237708.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_003923.1003749.p0 Protein 1e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_002758.1121668.p0 Protein 2e-22 41
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component NC_009641.5332272.p0 Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component VFG0596 Protein 7e-41 56
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component VFG1390 Protein 3e-27 45
AvCA_15530 YP_007892553.1 heavy metal response regulator, two-component VFG1389 Protein 3e-22 44