Gene Information

Name : RORB6_04715 (RORB6_04715)
Accession : YP_007873188.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1075329 - 1075649 bp
Length : 321 bp
Strand : +
Note : COG0640 Predicted transcriptional regulators

DNA sequence :
ATGCCGCATCCGCTAGAGGTTTTTAAAATATTGTCTGACGCCACGCGCCTGACGATCGTGATGTTGCTCAGGGAGCAAGG
TGAACTGTGCGTCTGCGATATTTGCGCGCTGACAGCGGAATCACAACCCAAAATCTCCCGTCATATGGCGATTCTTCGCG
AGGGAGGGCTGGTTCTTGACCGTCGGGAAGGGAAATGGGTGCACTACCGTTTGTCGCCGCATATGCCGGCCTGGGCGGCA
GAGATCATCGACAGCGCATGGCGATGTCTGCGTGATGAGGTGCGTGCCCGGGTCGCTGACGCTTCGCCGTCTTCCTGCTG
A

Protein sequence :
MPHPLEVFKILSDATRLTIVMLLREQGELCVCDICALTAESQPKISRHMAILREGGLVLDRREGKWVHYRLSPHMPAWAA
EIIDSAWRCLRDEVRARVADASPSSC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 3e-29 59
arsR AFC76435.1 ArsR Not tested AbaR5 Protein 1e-17 48
arsR CAJ77018.1 arsenite inducible repressor Not tested AbaR1 Protein 8e-18 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_04715 YP_007873188.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 1e-32 78
RORB6_04715 YP_007873188.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 7e-32 65
RORB6_04715 YP_007873188.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 4e-30 61
RORB6_04715 YP_007873188.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 5e-30 61