Gene Information

Name : RORB6_24425 (RORB6_24425)
Accession : YP_007877117.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein marA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5346812 - 5347165 bp
Length : 354 bp
Strand : +
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :

ATGAACACTGGCGCTTTTATACATGATTTACTTGACTGGATTGATAATAACCTTGAAAGCCGCCTCGATATCGACACGGT
CTCCAGGCGGGCAGGCTATTCAAAATGGCATCTTCAGCGGATATTCAAAGAGCATACCGGTCATCCCATTGGCGAATACA
TCCGCGCCCGGAAGCTGCAAAAATCGCTTGAGCGCTTAACCCGCAGCGACGAACCGATCCTCAACGTGGCCATCGCGTTG
GGTTTTGACTCCCAGCAATCCTTCAATCGCAGCTTCAAGCGCCAGTATGGCCAGGCGCCGGGAGTCTGGCGCCGCAGCAT
GGGAATGGCTCCATCGTGCCAGCGTCCAGGCTGA

Protein sequence :

MNTGAFIHDLLDWIDNNLESRLDIDTVSRRAGYSKWHLQRIFKEHTGHPIGEYIRARKLQKSLERLTRSDEPILNVAIAL
GFDSQQSFNRSFKRQYGQAPGVWRRSMGMAPSCQRPG

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
tetD	AAL08447.1	putative transcriptional regulator TetD	Not tested	SRL	Protein	2e-18	45
tetD	AEA34665.1	tetracycline resistance protein D	Not tested	Not named	Protein	2e-18	45

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	CP001918.1.gene2033.	Protein	4e-24	54
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	CP000647.1.gene1624.	Protein	4e-24	54
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	CP001138.1.gene1637.	Protein	5e-24	54
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	NC_002695.1.917339.p	Protein	4e-24	51
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	BAC0560	Protein	4e-24	51
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	CP000034.1.gene1596.	Protein	3e-24	51
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	NC_010558.1.6276025.	Protein	7e-19	45
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	CP001138.1.gene612.p	Protein	3e-21	42
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	BAC0371	Protein	4e-23	41
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	NC_002695.1.914293.p	Protein	4e-23	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RORB6_24425	YP_007877117.1	multiple antibiotic resistance protein marA	VFG1038	Protein	6e-19	45