Gene Information

Name : RORB6_09005 (RORB6_09005)
Accession : YP_007874042.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1990740 - 1991459 bp
Length : 720 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGCCCAAAAAAGTGTTAATTATTGAAGATGATGAAAATATCGCGGAGCTTCTGCAGCTACATTTATGCGAAGAGGG
CTATGAAATCAGCCATGCTGCTGAAGGCGTCGGTGGGCTGGCGATGGTCAGGCAGGGCGGCTGGGACGCGCTGATCCTCG
ATCTGATGTTACCGGGCATCGACGGTCTGGAGATCTGCCGGCATGCTCGCACTATGGCAAGCTACATGCCGATAGTGATA
ATCAGCGCGCGCTCAAGTGAAGTCCATCGTGTCCTGGGGCTGGAGCTCGGGGCAGATGACTACCTCGCGAAACCCTTTTC
AATGCTTGAACTGGTGGCGCGAGTGAAGGCGCTCTTCCGCCGTCAGGAGGCCATGACCCAGAATCTGATGCAGGACGCCG
GCATGTTGCATATTGACCGGCTGGCCATCGACCCGCTTGCGCGCGAAGCGCGCCTGCGCGATCTCCCGCTTGACCTGACG
CCGCGCGAGTTCGACCTGCTGTGGTTCTTTGCCAGGCATCCCGATAAGGTCTTTTCCCGCATCAGCTTGCTCAACCAGGT
CTGGGGCTATCAGCATGAAGGGTATGAGCATACGGTCAACACGCACATTAATCGGCTGAGGATGAAAATAGAAGATAATC
CGGCGGAGCCGGAGTTTATCCTGACGGTTTGGGGAAAAGGCTACAAATTTACGGCCCCGCACCCCGAGCCTGGCTGCTGA

Protein sequence :
MKPKKVLIIEDDENIAELLQLHLCEEGYEISHAAEGVGGLAMVRQGGWDALILDLMLPGIDGLEICRHARTMASYMPIVI
ISARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALFRRQEAMTQNLMQDAGMLHIDRLAIDPLAREARLRDLPLDLT
PREFDLLWFFARHPDKVFSRISLLNQVWGYQHEGYEHTVNTHINRLRMKIEDNPAEPEFILTVWGKGYKFTAPHPEPGC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-67 63
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-67 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-39 46
RORB6_09005 YP_007874042.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 44
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 43
RORB6_09005 YP_007874042.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-38 42
RORB6_09005 YP_007874042.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-30 42
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-30 42
RORB6_09005 YP_007874042.1 two component transcriptional regulator BAC0039 Protein 3e-30 42
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-38 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-31 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-41 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-29 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-30 41
RORB6_09005 YP_007874042.1 two component transcriptional regulator BAC0596 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_09005 YP_007874042.1 two component transcriptional regulator VFG1563 Protein 1e-67 63
RORB6_09005 YP_007874042.1 two component transcriptional regulator VFG1702 Protein 2e-67 62