Gene Information

Name : RORB6_05990 (RORB6_05990)
Accession : YP_007873443.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1348110 - 1348490 bp
Length : 381 bp
Strand : -
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGTCCAGACGCAATAATGACGCCATCACTATCCATAGTATTTTGTCGTGGATTGAAGATAACCTGGAATCGCCCCTGTC
GCTGGAAAAAGTGTCCGAGCGTTCTGGTTACTCCAAATGGCACCTGCAAAGAATGTTTAAAAAAGAGACCGGTCACTCCT
TAGGCCAGTACATCCGCAGTCGCAAGCTGACGGAAATCGCGCAAAAACTCAAGCAGAGCAATGAGCCGATTTTGTACCTG
GCAGAACGTTACGGTTTCGAATCGCAACAAACGCTGACGAGAACCTTTAAAAACTACTTCGACGTTCCGCCGCACAAATA
TCGCATGACCAATATGCCGGGTGAATCCCGCTATCTGATGCCACTAAACAACTGCTGTTAA

Protein sequence :
MSRRNNDAITIHSILSWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNMPGESRYLMPLNNCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-21 45
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-21 45
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 3e-53 98
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 7e-53 93
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA BAC0560 Protein 1e-52 93
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 1e-52 93
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 2e-52 93
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 2e-52 92
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 5e-22 45
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 4e-22 44
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA BAC0371 Protein 7e-20 43
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 1e-19 43
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 7e-20 43
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 6e-20 43
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 5e-20 43
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA VFG1038 Protein 5e-22 45
RORB6_05990 YP_007873443.1 DNA-binding transcriptional activator MarA VFG0585 Protein 6e-20 43