Gene Information

Name : PALO_08765 (PALO_08765)
Accession : YP_007871713.1
Strain : Propionibacterium avidum 44067
Genome accession: NC_021064
Putative virulence/resistance : Virulence
Product : sensory transduction protein RegX
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1906794 - 1907474 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACCCGCGTGCTCATCATCGAGGACGAGGAGTCCTACCGCGAGGCCACCGCCTTCATGCTGCGCAAGGAGGGATTTGA
GGTCGACACCGCGGCCAATGGTGCCGACGGACTGGAAAACTACTCCCGCAATGGCGCCGACATCGTCCTGCTTGACCTCA
TGATGCCGGGAATCCCGGGGACCGAGGTCTGCCGGCAGCTGCGTCAGCGTGGCAACGTCGGGATCATCATGGTGACGGCC
AGGGATTCCGAGATCGACAAGGTCGTCGGTCTGGAACTGGGAGCTGACGACTACGTCACCAAACCCTTCAGCCACCGCGA
GCTGGTCGCACGCATCCGCGCCGTCACTCGTCGAGGTGGCCCGGAGATCGAGGTCTCCCCCGACGTCCTCGAGGAGAACG
GGGTGCGGATGGACGTCGAGCGCCACGAGGTCAGTGTCGACGGAAAGACCGTGCGCCTCGCCCTCAAGGAGTTCGACCTG
CTCGAGGTGCTGCTGCGCAATGCTGGACGTGTCATGACCCGCGCGTCCCTCATCGACCGAGTCTGGGGGGTCGACTACGT
CGGCGACACCAAGACCCTAGACGTCCACGTCAAGAGGTTGCGCGCGAAGATCGAGAAGGATCCCTCACATCCGGCACGGA
TCATCACCGTGCGTGGACTCGGCTACAAGTTCCAGGCCTGA

Protein sequence :
MTRVLIIEDEESYREATAFMLRKEGFEVDTAANGADGLENYSRNGADIVLLDLMMPGIPGTEVCRQLRQRGNVGIIMVTA
RDSEIDKVVGLELGADDYVTKPFSHRELVARIRAVTRRGGPEIEVSPDVLEENGVRMDVERHEVSVDGKTVRLALKEFDL
LEVLLRNAGRVMTRASLIDRVWGVDYVGDTKTLDVHVKRLRAKIEKDPSHPARIITVRGLGYKFQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_012469.1.7685629. Protein 3e-47 46
PALO_08765 YP_007871713.1 sensory transduction protein RegX AE000516.2.gene3505. Protein 4e-42 45
PALO_08765 YP_007871713.1 sensory transduction protein RegX HE999704.1.gene2815. Protein 5e-44 44
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_012469.1.7686381. Protein 9e-45 43
PALO_08765 YP_007871713.1 sensory transduction protein RegX AE015929.1.gene1106. Protein 2e-34 42
PALO_08765 YP_007871713.1 sensory transduction protein RegX CP001918.1.gene5135. Protein 1e-26 42
PALO_08765 YP_007871713.1 sensory transduction protein RegX Y16952.3.orf35.gene. Protein 5e-22 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX BAC0638 Protein 3e-26 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX HE999704.1.gene1528. Protein 4e-31 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_002952.2859905.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_002745.1124361.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_009782.5559369.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_002951.3237708.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_003923.1003749.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_002758.1121668.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_007622.3794472.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_009641.5332272.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_013450.8614421.p0 Protein 5e-42 41
PALO_08765 YP_007871713.1 sensory transduction protein RegX NC_007793.3914279.p0 Protein 5e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PALO_08765 YP_007871713.1 sensory transduction protein RegX VFG0596 Protein 5e-33 42
PALO_08765 YP_007871713.1 sensory transduction protein RegX VFG1386 Protein 1e-32 42
PALO_08765 YP_007871713.1 sensory transduction protein RegX VFG1389 Protein 2e-29 41