Gene Information

Name : F750_4899 (F750_4899)
Accession : YP_007861821.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5083351 - 5084010 bp
Length : 660 bp
Strand : +
Note : -

DNA sequence :
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGCCTCGCCACGTCCCTCGCGAGGGGGCTGACCGCCGAGGGCTTCGCCGT
CGACGTCGTGCACGACGGACTGGAGGGCCTGCACCTGGCCGGCCAGGGCGTGTACGACCTCGTGGTCCTCGACATCATGC
TCCCCGGGATGAACGGCTACCGGATCTGCGCCGCCCTGCGGGCTGCCGGGCACGAGACGCCGATCCTGATGCTGACCGCG
AAGGACGGGGAGTACGACGAGGCGGAGGGTTTGGACACGGGCGCCGACGACTACCTGACCAAGCCGTTCTCGTACGTCGT
TCTCGTCGCCCGTGTCAGGGCGCTGCTGCGCCGCCGCGGCGGCTCCGCCTCGCCGGTGCTGACCGCCGGGACGCTGCGGA
TGGACACCGCCGCCCGGCGGGTGCACCGGGGCGAGGACGAAGTCACCCTCACGACGAAGGAGTTCGCGGTCCTGGAACAG
CTCGTGCGGCGGGCGGGCGAGGTGGTCAGCAAGGCGGACATCCTGGAGCACGTCTGGGACTTCGCCTACGACGGCGACCC
GAACATCGTCGAGGTCTACATCAGCACCCTGCGCCGCAAGCTCGGCGCCGCGGCGATCCGTACGGTACGCGGCGCCGGCT
ACCGGCTGGAGGCGCTGTGA

Protein sequence :
MRLLIVEDEKRLATSLARGLTAEGFAVDVVHDGLEGLHLAGQGVYDLVVLDIMLPGMNGYRICAALRAAGHETPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVRALLRRRGGSASPVLTAGTLRMDTAARRVHRGEDEVTLTTKEFAVLEQ
LVRRAGEVVSKADILEHVWDFAYDGDPNIVEVYISTLRRKLGAAAIRTVRGAGYRLEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-36 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F750_4899 YP_007861821.1 two-component response regulator BAC0197 Protein 7e-38 49
F750_4899 YP_007861821.1 two-component response regulator BAC0083 Protein 1e-36 46
F750_4899 YP_007861821.1 two-component response regulator BAC0111 Protein 2e-38 46
F750_4899 YP_007861821.1 two-component response regulator BAC0308 Protein 5e-38 46
F750_4899 YP_007861821.1 two-component response regulator Y16952.3.orf35.gene. Protein 8e-28 46
F750_4899 YP_007861821.1 two-component response regulator BAC0125 Protein 3e-39 45
F750_4899 YP_007861821.1 two-component response regulator U82965.2.orf14.gene. Protein 3e-27 45
F750_4899 YP_007861821.1 two-component response regulator BAC0347 Protein 1e-32 44
F750_4899 YP_007861821.1 two-component response regulator BAC0638 Protein 8e-30 44
F750_4899 YP_007861821.1 two-component response regulator BAC0487 Protein 1e-24 43
F750_4899 YP_007861821.1 two-component response regulator NC_002516.2.879194.p Protein 2e-25 42
F750_4899 YP_007861821.1 two-component response regulator AE000516.2.gene3505. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F750_4899 YP_007861821.1 two-component response regulator VFG0596 Protein 3e-36 45
F750_4899 YP_007861821.1 two-component response regulator VFG1389 Protein 1e-30 43
F750_4899 YP_007861821.1 two-component response regulator VFG1386 Protein 2e-30 42
F750_4899 YP_007861821.1 two-component response regulator VFG1390 Protein 7e-38 41