Gene Information

Name : terD (F750_3988)
Accession : YP_007860917.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4168549 - 4169124 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCCCCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGCGGTCAACAACGCCGGCAAGG
TCTACTCCGACGGCCACTTCGTCTTCTTCAACAACAAGGCGACGCCGGACCAGACCATCGTCCACACCGGTGACAACATC
ACCGGCCAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCGGGCCTCCCGGCGGACATCGACAAGATCGTGTT
CCCGGTCTCCATCTACGACGCCGAGGCCCGCAGCCAGAACTTCGGCCAGGTGCGGAACGCCTTCATCCGCATCGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTCAGCGAGGACGCCGCCACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGTTACGCATCGGGTCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACCTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNNAGKVYSDGHFVFFNNKATPDQTIVHTGDNI
TGQGEGDDEQINVNLAGLPADIDKIVFPVSIYDAEARSQNFGQVRNAFIRIVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLRGIAQDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_007860917.1 tellurium resistance protein TerD BAC0390 Protein 1e-58 62
terD YP_007860917.1 tellurium resistance protein TerD BAC0389 Protein 2e-56 60