Gene Information

Name : terD (F750_2236)
Accession : YP_007859214.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2309677 - 2310252 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGCTGACCAAGGCCGCGCCGAACCTGACCGCGGTCATCGTCGGTCT
GGGCTGGGATGCCCGGACGACCACCGGCGGTGACTTCGACCTCGACGCCAGCGCTCTGCTGACGAACGCCGAGGGCAAGG
TCGGCAGCGACGGGAATTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAAGGTCAACCTCTCGGGCGTCCCCGCCGACGTCGACAAGATCGTCTT
CCCGGTCTCGATCTACGAGGCCGAGAGCCGTCAGCAGAGCTTCGGCCAGGTCCGCAACGCGTACATCCGCGTGGTGAACC
AGGCGGACAACAGCGAGCTCGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCCTCGGGTCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVIVGLGWDARTTTGGDFDLDASALLTNAEGKVGSDGNFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVIKVNLSGVPADVDKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADNSELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-62 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-61 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-57 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-29 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_007859214.1 tellurium resistance protein TerD BAC0389 Protein 2e-61 65
terD YP_007859214.1 tellurium resistance protein TerD BAC0390 Protein 1e-58 63
terD YP_007859214.1 tellurium resistance protein TerD BAC0392 Protein 3e-28 43