Gene Information

Name : terD (F750_1105)
Accession : YP_007858100.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1100450 - 1101025 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
GTGGGAGTCAGCCTGTCCAAGGGCGGAAACGTATCGCTCAGCAAGGAGGCCCCCGGCCTCACCGCCGTGACGGTCGGGCT
CGGCTGGGACGTGCGCACCACCACCGGTGCCGATCACGACCTCGACGCCAGCGCCCTGCTGTGCACCGAAGCCGGCAAGG
TGGTCTCCGACCGGCACTTCGTCTTCTACAACAACCTCAACAGCCCCGACGGTTCGGTCCAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGTCCATCAACGTGGACCTGTCGTCGGTGCCCGCCGAGGTGTCGAAGATCGTCTT
CCCGGTCTCCATCCATGACGCGACGGCGCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTTCATCCGGGTGATCAACC
GGTCCGACAACGTCGAACTGGCCCGCTACGACCTGAGCGAGGACGCCTCGACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGTCACGGCAGCGAGTGGAAGTTCCGCGCGGTGGGCCAGGGATACGCCTCCGGTCTGGCAGGTATTGCCGCCGACTT
CGGCGTCAACATCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASALLCTEAGKVVSDRHFVFYNNLNSPDGSVQHTGDNL
TGEGEGDDESINVDLSSVPAEVSKIVFPVSIHDATARGQSFGQVRNAFIRVINRSDNVELARYDLSEDASTETAMVFGEL
YRHGSEWKFRAVGQGYASGLAGIAADFGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-59 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-30 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_007858100.1 tellurium resistance protein TerD BAC0389 Protein 7e-59 67
terD YP_007858100.1 tellurium resistance protein TerD BAC0390 Protein 1e-60 65
terD YP_007858100.1 tellurium resistance protein TerD BAC0392 Protein 3e-26 43