Gene Information

Name : CLS_39270 (CLS_39270)
Accession : YP_007850986.1
Strain : Clostridium saccharolyticum K10
Genome accession: NC_021047
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3763641 - 3764318 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGGAGACACTTAAAATATTAGTGGTGGACGATGAGCCAAGGATGAGGAAGCTGGTAAAGGACTTCCTGACCGTTAAGGG
CTTCCAGGTGGTGGAGGCCGGAGACGGCGAGGAGGCTATTGACATTTTCTTTGAGCAGAAGGATATTGCCTTAATTCTTT
TAGATGTGATGATGCCGAAAATGGATGGCTGGGAGGTGTTAAAGACCATCAGAAAGTACTCCCAGGTTCCGATTCTCATG
CTGACAGCCAGAGGGGAGGAGCAGGATGAGCTGCAGGGCTTCAAGCTGGGAGTAGATGAGTACATTTCGAAGCCTTTCAG
CCCTAAAATCCTGGTGGCCAGAGTGGAAGCGATTCTCAGAAGGAGCAGCCCTGGCGCAAAGGATGTGATCGATGTAGGAG
GAATTCACATTGACAAGACAGCCCATCAGGTAGAGATTGACGGAAAACCAGTGGATTTAAGTTACAAGGAATTTGAGCTG
ATGACATATTTTGCTGAAAACCAGGGAATTGCACTGTCCAGGGAAAAGATTCTGAACAATGTCTGGAACTACGATTACTT
TGGAGATGCCAGAACCATTGACACCCATGTGAAAAAACTCAGGAGCAAGCTGGGAGAGAAAGGCGAATACATCAAGACAA
TCTGGGGCATGGGCTATAAGTTTGAGGTAGAGTCATGA

Protein sequence :
METLKILVVDDEPRMRKLVKDFLTVKGFQVVEAGDGEEAIDIFFEQKDIALILLDVMMPKMDGWEVLKTIRKYSQVPILM
LTARGEEQDELQGFKLGVDEYISKPFSPKILVARVEAILRRSSPGAKDVIDVGGIHIDKTAHQVEIDGKPVDLSYKEFEL
MTYFAENQGIALSREKILNNVWNYDYFGDARTIDTHVKKLRSKLGEKGEYIKTIWGMGYKFEVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-40 47
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-39 44
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 1e-38 43
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 3e-41 41
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1202. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLS_39270 YP_007850986.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 9e-34 43