Gene Information

Name : ERE_20000 (ERE_20000)
Accession : YP_007842715.1
Strain : Eubacterium rectale M104/1
Genome accession: NC_021044
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2028384 - 2028590 bp
Length : 207 bp
Strand : -
Note : -

DNA sequence :

ATGACTGTAAGCTATAATAAATTATGGAAAAGACTTATAGATTTAAATATGAGCAAAACTCAGCTTAGAGAAAAAGCCGG
TATAACAACAAATGCAATAGCAAAGATGGGAAAAAATGAGAATGTTTCGACAGAAATTATATGTAAAATATGCAAAGTAT
TGGAATGTCAGGTAGAAGATGTAATCGAATTAGTTGATGAAGAATAA

Protein sequence :

MTVSYNKLWKRLIDLNMSKTQLREKAGITTNAIAKMGKNENVSTEIICKICKVLECQVEDVIELVDEE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
EFAU085_00700	YP_008394224.1	putative transcriptional regulator	Not tested	Not named	Protein	1e-12	52
cpfrc_01461	YP_003783861.1	hypothetical protein	Not tested	PiCp 5	Protein	4e-11	45
CpC231_1455	YP_005683818.1	hypothetical protein	Not tested	PiCp 5	Protein	3e-11	45
CpI19_1462	YP_005685904.1	hypothetical protein	Not tested	PiCp 5	Protein	3e-11	45
Cp1002_1456	YP_005681720.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-10	43

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
ERE_20000	YP_007842715.1	transcriptional regulator	DQ212986.1.gene3.p01	Protein	3e-12	53