Gene Information

Name : ROI_00370 (ROI_00370)
Accession : YP_007830440.1
Strain : Roseburia intestinalis M50/1
Genome accession: NC_021040
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 23223 - 23897 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATTTTTTTGGCGGAAGATGAACAGGATTTAAATGCCATTATTGTTCAAAAACTGACTGAGGATGGTTACAGTGT
GGATCATTGTTTTGATGGCAGGACAGCAATAGATATCCTTTCCTGTACGGAGTATGATGCAGTGATTCTTGATATTATGA
TGCCAAAAGCAGATGGATTTACAGTGCTGCGTGCGCTGAGGGGAATGGGAAAGACAACACCGGTGCTATTTCTGACAGCA
AAGGATGCTGTTTCGGACAGAGTAAAGGGATTAGACAGTGGAGCAAATGATTATCTTGTGAAGCCATTTTCGTTTGAAGA
GTTGTCAGCACGTCTGCGTGCAATGATGAGGGGATCTTTCGGAGTTACTGACAATGTTTTGCATATTGCGGATCTTTCTT
TGGATTGCACTTCCCACAGGGTAATGCGGGGGGGAAAAGAGATCACATTATCGGCTAAAGAATATGCCATGCTGGAATAT
TTCATGTACAATCAGGGGCGTGTGCTGTCTCGTGAGATGATAGAGGATCATGTCTGGAATTTTGATTACGAAGGGGGCAC
GAATATAGTGGATGTTTATATCAGCTATCTTCGAAAAAAAATTGATGGTGGATATGACAAAAAGCTGATTCATACAGTCC
GTGGAAGAGGATTTATAATGAGAGAGGAAATTTAA

Protein sequence :
MRIFLAEDEQDLNAIIVQKLTEDGYSVDHCFDGRTAIDILSCTEYDAVILDIMMPKADGFTVLRALRGMGKTTPVLFLTA
KDAVSDRVKGLDSGANDYLVKPFSFEELSARLRAMMRGSFGVTDNVLHIADLSLDCTSHRVMRGGKEITLSAKEYAMLEY
FMYNQGRVLSREMIEDHVWNFDYEGGTNIVDVYISYLRKKIDGGYDKKLIHTVRGRGFIMREEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-42 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-41 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 7e-47 48
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 2e-48 46
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 1e-46 46
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 5e-45 45
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 4e-44 45
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 2e-44 45
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 2e-47 42
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 7e-36 41
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-42 47
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 3e-47 44
ROI_00370 YP_007830440.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 4e-45 44