Gene Information

Name : CIY_05610 (CIY_05610)
Accession : YP_007818551.1
Strain : Butyrivibrio fibrisolvens 16/4
Genome accession: NC_021031
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 492963 - 493652 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAGTAGAATATTAATCATCGAAGATGAGGAAGCGATTGCTGAGCTTGAAAAGGATTACTTAGAGCTTTCAAACTTTGA
AGTAGATATAGAGGCTGACGGAGAAAAGGGCCTGCAGAAGGCGCTTGCTGGAAATTATGATATGTACATTTTGGATTTAA
TGCTTCCAGGAATAGATGGATTCGAGCTTTGCAAGAGAATTCGTGAGGTCAAGAATGTACCAATTCTTATGGTTACAGCT
AAAAAAGAGGAGATTGACAAAATCCGTGGCCTGGGATTAGGAGCAGATGATTACATCACTAAGCCTTTCTCACCAAGCGA
GCTTGTTGCCCGTGTAAAGGCACATTTGGCCAGATACGAAAGACTGGTGCAGTCTCCTAATATCCAAAAGGATGAAATTA
GCATCCGCGGTCTTAGAATAGACAAGGCCAGCCGTAGAGTTTGGATTAATGGCGAAGAGAAAACATTTACTGCTAAGGAG
TTCGATTTACTCACATTTTTAGCAGAAAATCCAAACGTAATTTATTCAAAAGAGCAGCTGTTTGAAACACTCTGGGGAGA
GGAATCCATCGGAGATATTTCCACAGTAACTGTTCACGTAAATAAAATCCGCGAGAAAATCGAGCTTAACACATCAAAGC
CTCAGTATATCGAGACTATCTGGGGTGTTGGTTATCGCTTCAAAGTCTGA

Protein sequence :
MSRILIIEDEEAIAELEKDYLELSNFEVDIEADGEKGLQKALAGNYDMYILDLMLPGIDGFELCKRIREVKNVPILMVTA
KKEEIDKIRGLGLGADDYITKPFSPSELVARVKAHLARYERLVQSPNIQKDEISIRGLRIDKASRRVWINGEEKTFTAKE
FDLLTFLAENPNVIYSKEQLFETLWGEESIGDISTVTVHVNKIREKIELNTSKPQYIETIWGVGYRFKV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR YP_006309898.1 NisR Not tested FWisland_1 Protein 2e-24 43
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 9e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 5e-40 47
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 5e-33 46
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 1e-39 46
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 5e-34 46
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 8e-36 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-37 45
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 2e-36 44
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 1e-36 44
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 1e-36 44
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 1e-35 43
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-34 42
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 3e-40 42
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 2e-37 42
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 4e-35 42
CIY_05610 YP_007818551.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001581.1.gene280.p Protein 2e-32 41