Gene Information

Name : CL3_29720 (CL3_29720)
Accession : YP_007810517.1
Strain : butyrate-producing bacterium SM4/1
Genome accession: NC_021024
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2598980 - 2599606 bp
Length : 627 bp
Strand : -
Note : -

DNA sequence : 
ATGAGAATTTTATTTGCAGAGGATGAGCCGGCCCTCAGGGAAGTGACGGTAAAGCGGCTTAAGGCGGAAGGGTTTGGCGT
AGACGGATGCAGGGACGGCAGGGAGGCTCTCGATTATCTGGACAGCACAGACTACGACGTGGTGATTCTGGATATTATGA
TGCCTGGAATCGACGGGCTGACCGTGCTTCGAACACTCAGAAGCCGGGGAAATACGGCGCCTGTCATGCTTCTGACAGCC
AGGGACGCCGTCGCTGACCGGGTGGGAGGGCTGGACGCCGGGGCAGACGACTACCTGACAAAGCCCTTTGAATTTGCGGA
GCTGACTGCCCGCATCCGCGCTCTGCTTAGAAGAAATTCTGACAATAAGACGGATACGGCCTCTATGGCAGATCTGACAG
TGGAGTTTTCCACCAGGAAAGTGACGAGGGGAGGAGTGGAGATCAGCCTTTCTTCCCGGGAATTTGCCCTGCTGGAATCC
CTGATCCGCCATAAGGGAGCCATACTCTCACGCACACAGCTGGAAAACCAGGTCTGGGATTTTGGCTTTGAGGGGGAAGC
AACATTGTGGATGTCTATATCCGTTATCTCAGAAAAAAGATTGACGATCCCTTTGAGAAGAAGCTGA

Protein sequence : 
MRILFAEDEPALREVTVKRLKAEGFGVDGCRDGREALDYLDSTDYDVVILDIMMPGIDGLTVLRTLRSRGNTAPVMLLTA
RDAVADRVGGLDAGADDYLTKPFEFAELTARIRALLRRNSDNKTDTASMADLTVEFSTRKVTRGGVEISLSSREFALLES
LIRHKGAILSRTQLENQVWDFGFEGEATLWMSISVISEKRLTIPLRRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 1e-38 48
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 3e-39 48
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 5e-38 47
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 2e-34 47
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 6e-36 46
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 4e-39 45
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 1e-36 41
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-25 41
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene1136. Protein 6e-26 41
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0530 Protein 7e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 4e-37 48
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-32 44
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-34 44
CL3_29720 YP_007810517.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0473 Protein 1e-30 41