Gene Information

Name : GPA_15500 (GPA_15500)
Accession : YP_007802493.1
Strain : Gordonibacter pamelaeae 7-10-1-bT
Genome accession: NC_021021
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1563511 - 1564206 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGAACGATACACCGAACCGCATCCTCGTCGTGGACGACGAGCCTTCCATAACGGAATTCGTCAGCTACGCCCTGAAGAA
GGAGGGCTTCTACACCGACGTGGTGGACAACGGCGAAGAGGCCCTGGCCCTGGCGACCAAGAACCCCTACGACCTGTTCG
TTCTCGACATCATGCTGCCCGGCATGGACGGCTACGAGCTGTGCCGCCGCCTGCGCTCCAAGACCACGGTGCCCGTGCTG
TTCCTGTCGGCGCGCGACACGGAGCTCGACAAGGTGGTTGGCCTGGAGATCGGCGGGGACGACTACCTGGCCAAGCCGTT
CGGCGTGCGCGAGCTCATCGCCCGCGTCCGCGCGCTGCTGCGCCGCGGCTCCGGCGGCGACTTCCCCGGGGCGAACCACG
CCATCACGGCCAGCGGCATCACGCTGGACGAGGACGCCCACACGGCGTCGGGCGAGCATGGCGAGATCGACCTCACGCCG
CGCGAGTTCGAGCTCTTGGCCAGCCTGATGAAGAACGCCGGCAAGGTGGTGTCGCGCGAGGACCTGCTGCGCGACGCGTG
GGGTTGGGAATACTTGACGGAAACCAAGACGGTCGACACCCACATCAAGCGCCTCCGTGATAAGATTGAGGGTGCCGGGT
ACGATCCCGGCTTGGTGGAGACGGTTCGCGGATACGGGTACAGGTTCAGACAATAA

Protein sequence :
MNDTPNRILVVDDEPSITEFVSYALKKEGFYTDVVDNGEEALALATKNPYDLFVLDIMLPGMDGYELCRRLRSKTTVPVL
FLSARDTELDKVVGLEIGGDDYLAKPFGVRELIARVRALLRRGSGGDFPGANHAITASGITLDEDAHTASGEHGEIDLTP
REFELLASLMKNAGKVVSREDLLRDAWGWEYLTETKTVDTHIKRLRDKIEGAGYDPGLVETVRGYGYRFRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-48 45
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 7e-43 44
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-44 43
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 7e-40 42
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-47 42
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 8e-40 42
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 5e-40 42
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 4e-39 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 9e-39 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-44 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-44 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 6e-31 43
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 5e-36 41
GPA_15500 YP_007802493.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 5e-36 41