Gene Information

Name : GPA_17100 (GPA_17100)
Accession : YP_007802592.1
Strain : Gordonibacter pamelaeae 7-10-1-bT
Genome accession: NC_021021
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1721321 - 1722010 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGATCTACTACGTTGAAGACGATACCAATATCCGCGACCTTACGGTGTACGCGCTCAAGCAGGCCGGTTTCGAGGCGGC
GGGCTTTGCCGCGGCGGGGGAGTTCTTCGTCGCCTGCAAGCGGCGCCTGCCGGAGCTCGTGCTGCTGGACATCATGCTGC
CCGAAGTGGACGGCCTGGAGATCCTGCACATGCTGCGGGAGGACCCGGCCACGAAGCACCTGCCCGTCATGATGCTCACG
GCCAAGGGCACGGAGTTCGACACGGTGAGCGGCCTCGATGCCGGCGCCGACGACTACCTGGCCAAGCCGTTTGGCATGAT
GGAGCTGGTGAGCCGCGTGAACGCGCTCATGCGTCGCGCCGCCGCGCCGGCCGTGGCGGCCGACGACGAGTTCTCGTGCG
GCCCCATTGCGCTCACGGTGTCGTCGCACGACGTCTCCGTGGACGGCGAGAACGTTGCGCTCACGCTCAAGGAGTTCGAC
CTTCTGCGCACGCTCATGCAGAACGAGGGGCATGTGCTGTCGCGTCGCCAGCTTTTGGAGGACGTGTGGGGCATGACCTA
CGTGGGCGAGACGCGCACGGTCGACGTGCACATCCAGACGCTTCGGCAGAAGCTCGCGGCGGCCGTCGAGGGTGCAGACG
CCTACATCCAGACGGTGCGCGGCGTGGGCTACTGCGTCAAGCAGCCATGA

Protein sequence :
MIYYVEDDTNIRDLTVYALKQAGFEAAGFAAAGEFFVACKRRLPELVLLDIMLPEVDGLEILHMLREDPATKHLPVMMLT
AKGTEFDTVSGLDAGADDYLAKPFGMMELVSRVNALMRRAAAPAVAADDEFSCGPIALTVSSHDVSVDGENVALTLKEFD
LLRTLMQNEGHVLSRRQLLEDVWGMTYVGETRTVDVHIQTLRQKLAAAVEGADAYIQTVRGVGYCVKQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-26 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 4e-33 43
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 5e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-30 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-32 42
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 2e-25 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 7e-30 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 4e-35 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 4e-32 43
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 2e-26 41
GPA_17100 YP_007802592.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 9e-27 41