Gene Information

Name : CCU_10100 (CCU_10100)
Accession : YP_007796056.1
Strain : Coprococcus sp. ART55/1
Genome accession: NC_021018
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1028179 - 1028853 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGTACATATTTATATTGTAGAAGACGATAAGAATATAAGAGAGATAGAGATGTTTGCTCTGAAAAACAGCGGATA
TGCGGTGGAGGAGTTTGAGAATGCGAAATCCTTCTTCTCAAGGTCTGCGGAGAAGGTCCCTGATCTGGTACTCCTGGATA
TCATGCTCCCAGACATGGATGGTCTTGAAATTGTGAAGAAGCTCAGGAGCAGACCTGATACTGTCAGAGTTCCGATTATC
CTTGTGACAGCCAAGACTACAGAGCTTGACAAGGTCAAGGGCTTGGATATAGGAGCGGATGATTACCTCACCAAGCCATT
TGGCGTGATGGAGCTCATATCCAGAGTCAAGGCGCTGCTCAGAAGAAGCAGGGCGCTGCAGGATGACAAGCAGCTGGTAC
TCGGGGATATAACCCTTGATTCAGAGAGACGCGAGGTGCATGTGGGCGGCGAGTTGTGTGAGCTTACCTTCAAGGAGTTT
GAACTCTTAAAGCTTCTCATGGTGAATGCAGGAATAGTTCTTCACAGAGACACAATCATGTCGGATGTGTGGGGAACGGA
TTACGAGGGCGAATCCAGAACCCTTGATATGCATATCAAGACTTTGAGACAGAAGCTTGGCGAAGCAGGTAATATGATAA
AGACAGTTAGAAATGTAGGGTATAAGATGGAGTAG

Protein sequence :
MAVHIYIVEDDKNIREIEMFALKNSGYAVEEFENAKSFFSRSAEKVPDLVLLDIMLPDMDGLEIVKKLRSRPDTVRVPII
LVTAKTTELDKVKGLDIGADDYLTKPFGVMELISRVKALLRRSRALQDDKQLVLGDITLDSERREVHVGGELCELTFKEF
ELLKLLMVNAGIVLHRDTIMSDVWGTDYEGESRTLDMHIKTLRQKLGEAGNMIKTVRNVGYKME

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 7e-26 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-30 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 5e-31 42
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 1e-28 42
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 1e-28 42
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 1e-32 42
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-28 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 6e-29 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 8e-31 41
CCU_10100 YP_007796056.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP004022.1.gene3215. Protein 1e-19 41