Gene Information

Name : CL2_03880 (CL2_03880)
Accession : YP_007788461.1
Strain : butyrate-producing bacterium SSC/2
Genome accession: NC_021016
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 360166 - 360855 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAGGAAGGTCTTAGTTGTTGATGATGAAAAACTAATCGTGAAGGGCATCAAATTCAGTCTGGAACAAGATGAGATGCA
AGTAGATTGTGCTTATGATGGAGAAGAAGCATTAGAGAAAGCCAAAGAGAATCAATATGATATTATTCTCCTTGACGTAA
TGCTTCCAGGACTGACTGGGTTTGAGGTTTGTCAGGCAATTCGTGAATTCTCTAGCGTCCCGATCATTATGTTGACGGCT
AAGGGAGAAGATATGGATAAGATTCTTGGCCTTGAATATGGGGCAGATGATTATATCACAAAGCCATTTAATATTCTGGA
AGTAAAGGCAAGGATCAAAGCAATCTTACGTCGAAGCGCACATCACGATGTGAAAGAAGAAGAATCAGCAAAGGTTGTAG
AATGCAGAGGTTTAAAGATTGACTGCGAAAGCCGCAGAGTGCATATTCATGGCAAAGAAGTGAACCTGACAGCGAAAGAA
TTTGACTTGTTAGAGTTACTGGTATTTCATCCAAACAAAGTATACAGCAGAGAGGATTTGTTGAATACAGTATGGGGATA
TGATTATCCGGGGGATGCAAGAACGGTTGACGTGCATATCCGAAGATTGAGAGAGAAGATCGAAGTGAATCCGGGAGTAC
CGGACTATGTACATACAAAGTGGGGGGTAGGTTACTATTTTCAGTCCTAA

Protein sequence :
MRKVLVVDDEKLIVKGIKFSLEQDEMQVDCAYDGEEALEKAKENQYDIILLDVMLPGLTGFEVCQAIREFSSVPIIMLTA
KGEDMDKILGLEYGADDYITKPFNILEVKARIKAILRRSAHHDVKEEESAKVVECRGLKIDCESRRVHIHGKEVNLTAKE
FDLLELLVFHPNKVYSREDLLNTVWGYDYPGDARTVDVHIRRLREKIEVNPGVPDYVHTKWGVGYYFQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-51 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 4e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 5e-45 50
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 1e-43 49
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 6e-44 47
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 5e-39 47
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 3e-36 46
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 7e-35 45
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 2e-34 45
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 6e-37 44
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene3444. Protein 3e-30 44
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 9e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 1e-41 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene2239. Protein 2e-31 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0596 Protein 2e-31 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0039 Protein 3e-31 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene2186. Protein 3e-31 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.916589.p Protein 3e-31 43
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000675.2.gene1535. Protein 2e-38 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 3e-38 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 7e-37 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 7e-37 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 7e-40 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 5e-34 41
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 2e-37 41
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene2531. Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-34 42
CL2_03880 YP_007788461.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 3e-40 41