Gene Information

Name : CL2_11700 (CL2_11700)
Accession : YP_007789148.1
Strain : butyrate-producing bacterium SSC/2
Genome accession: NC_021016
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1157997 - 1158668 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATATTAGTTGTTGAAGATGAAAAAGATTTAAGAAATATTATAAAGAAACGTTTGGTAAGAGAGCATTATAGTGT
GGATGCCTGTGGAGACGGAGAAGAAGCGCTAGATTATATGGAGATGACATCGTATGATGGAGTTCTTCTCGACATCATGC
TTCCTGGGAAGGATGGTTTTGCGGTTTTAAAGGAAGTCAGGCAGATGGGAAATGATACACCAATTCTCTTACTGACTGCA
AGGGATGGTATTGAGGACCGGGTAAAGGGGCTTGACCTAGGGGCCGATGATTATCTGATCAAGCCATTCGCGTTTGAAGA
GTTACTCGCAAGAATCCGCGTGATGATGCGGAGAAAACCCCAATTTGTAACGAATCAGTTAAAGATTGCAGATCTTACTT
TGGACCGGGATACAAGAATTGTGACAAGAGCTGGAAAAGAGATCAGTTTGTCGTCAAAAGAATTTATGGTGTTAGAATGT
CTGATGCGGAATCAGAATATCGTGATGACGAGGCAGCAGATTGAACAAAATGCATGGAATTATGATTATGAGGGAGGGTC
GAATGTTATTGATGTATATATAAGATATCTCCGAAAGAAAATTGATGCAGGATATGAGAAAAAACTGATCCATACGGTAC
GCGGAACAGGCTATGTGATGAGGGAAGAATGA

Protein sequence :
MRILVVEDEKDLRNIIKKRLVREHYSVDACGDGEEALDYMEMTSYDGVLLDIMLPGKDGFAVLKEVRQMGNDTPILLLTA
RDGIEDRVKGLDLGADDYLIKPFAFEELLARIRVMMRRKPQFVTNQLKIADLTLDRDTRIVTRAGKEISLSSKEFMVLEC
LMRNQNIVMTRQQIEQNAWNYDYEGGSNVIDVYIRYLRKKIDAGYEKKLIHTVRGTGYVMREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-42 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 2e-46 48
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 6e-38 47
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 2e-46 47
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 1e-42 47
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 2e-45 46
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 1e-42 46
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 2e-45 46
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-39 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 4e-46 45
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-35 44
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0288 Protein 7e-34 42
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 8e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 8e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 7e-32 41
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 8e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 1e-48 48
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 2e-42 44
CL2_11700 YP_007789148.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 2e-45 44