Gene Information

Name : RTO_30330 (RTO_30330)
Accession : YP_007787945.1
Strain : [Ruminococcus] torques L2-14
Genome accession: NC_021015
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3130232 - 3130924 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGAGTAAACGTATTTTAATCGTAGAAGACGAGGAAAGCATTGCAGATCTTGAGAAAGACTATCTGGAGCTGAGTGGTTT
TGAAGTCGAGGTTGCGAATGATGGTGAGATAGGACTTAAGAAAGGACTTGAAGGAGAATTTGATCTGATCATTCTGGATC
TGATGCTTCCGGGAGTAGATGGATTTGAGATCTGTCGTCAGATCCGCAGCCAGAAGAATACACCGATCATTATGGTTTCA
GCAAAGAAAGATGATATTGATAAGATTCGAGGGCTTGGACTTGGCGCAGATGATTATATGACAAAACCGTTCAGCCCAAG
TGAACTTGTAGCGCGTGTGAAAGCACATCTTGCAAGATATGAGAGACTGATCGGAAGTAATGTAGAGCAGAATGAAGTGA
TCGAGATCCGTGGATTGAAGATCGATAAGACAGCACGTCGCGTGTGGGTGAATGGAGAAGAGAAGTCTTTCACAACGAAA
GAATTTGACCTTTTAACTTTCCTTGCAGGACATCCGAATCATGTGTACAGCAAGGAAGAACTTTTCCGTGAGATCTGGGA
TATGGAGTCGATTGGAGACATTGCAACTGTTACAGTACATATTAAGAAGATCCGTGAGAAGATCGAATATGATACTTCAC
ATCCACAGTATATTGAGACAATCTGGGGTGTGGGATACAGATTTAAAGTATAA

Protein sequence :
MSKRILIVEDEESIADLEKDYLELSGFEVEVANDGEIGLKKGLEGEFDLIILDLMLPGVDGFEICRQIRSQKNTPIIMVS
AKKDDIDKIRGLGLGADDYMTKPFSPSELVARVKAHLARYERLIGSNVEQNEVIEIRGLKIDKTARRVWVNGEEKSFTTK
EFDLLTFLAGHPNHVYSKEELFREIWDMESIGDIATVTVHIKKIREKIEYDTSHPQYIETIWGVGYRFKV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSU05_0907 YP_001198273.1 NisR Not tested 89K Protein 5e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 6e-43 46
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-40 46
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 6e-42 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-43 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 7e-36 45
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 6e-42 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 6e-42 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-38 44
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-30 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_011595.7057856.p0 Protein 5e-37 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010400.5986590.p0 Protein 3e-36 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010410.6002989.p0 Protein 5e-37 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 1e-37 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 6e-40 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 1e-38 43
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 1e-36 42
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 6e-38 42
RTO_30330 YP_007787945.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-35 41