Gene Information

Name : RTO_22740 (RTO_22740)
Accession : YP_007787283.1
Strain : [Ruminococcus] torques L2-14
Genome accession: NC_021015
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2353820 - 2354494 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGATTTTTTGTGTAGAAGATGACGATAACATTCGCGAACTTGTAATCTACACTCTGGAGACAACCGGACTGGAAGCCAG
AGGGTTTGCAGACGGGACGGCATTTATGGAGGCTTTGGCGTTTGACACGCCAGAGCTTGTTTTGCTTGATATTATGCTTC
CGGGTGAAGATGGACTTGAGATTCTTAAGAAACTGAAAAATTCATCAAAGACAAAGGATATCCCTGTGATCATGGTGACA
GCGAAGGGGTCAGAGTATGATAAGGTAGTGGGATTGGATTCCGGTGCGGATGATTATGTGACGAAACCATTTGGTATGAT
GGAGCTGATTTCCAGAATCAAAGCAGTGCTTCGCAGAAGTGGAAAGCAACAGGATAAGACGAAACTTTCTGTTGGAGGAA
TCAGTTTAGATACGAAGAAACATGAAGTAAAAGTAGATGGCGAGCAAGTTGTGCTGACATTGAAGGAATTTGAACTTCTT
GAGAAATTGATGCGCAATCAGGGAATCGTGCTGACAAGAGACCAGCTACTGACAGAGATTTGGGGATATGATTTTGATGG
AGAGACGAGAACGGTTGATGTTCATATCCGGACACTCCGCCAGAAGTTAGGTGAGCAGGGCAGTCTGGTCAAGACAGTTC
GTGGTGTTGGATATCGGATCGGTGGAGAAGCGTAA

Protein sequence :
MIFCVEDDDNIRELVIYTLETTGLEARGFADGTAFMEALAFDTPELVLLDIMLPGEDGLEILKKLKNSSKTKDIPVIMVT
AKGSEYDKVVGLDSGADDYVTKPFGMMELISRIKAVLRRSGKQQDKTKLSVGGISLDTKKHEVKVDGEQVVLTLKEFELL
EKLMRNQGIVLTRDQLLTEIWGYDFDGETRTVDVHIRTLRQKLGEQGSLVKTVRGVGYRIGGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-27 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-26 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 5e-26 48
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-31 47
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 5e-28 43
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 5e-28 43
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 3e-22 43
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene4257. Protein 3e-22 43
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0533 Protein 3e-22 43
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 5e-29 42
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-33 42
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-28 42
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 8e-31 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 3e-32 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 9e-36 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-35 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 1e-32 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 5e-29 41
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene4273. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_22740 YP_007787283.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-27 43