Gene Information

Name : RTO_22280 (RTO_22280)
Accession : YP_007787241.1
Strain : [Ruminococcus] torques L2-14
Genome accession: NC_021015
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2305396 - 2306085 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGGAAAGAGCAAAAATATTAGTTGTGGATGACGAGAGCAGAATGAGAAAACTTGTGAAGGATTTCCTCACAAGAGAAGG
GTATATGGTATTAGAAGCCGGAGATGGAATGGAAGCAATGGATCTTTTTTACGAAGATAAAGACATTGCCCTGATCATTT
TAGATGTAATGATGCCGAAAATGGATGGCTGGCAGGTGTGCCGTGAGGTTCGAGAGACTTCTAAAGTGCCAATCATTATG
CTGACAGCGCGTTCTGAGGAGAGAGATGAGCTGCAGGGATTTGAACTTGGTGTGGACGAATACATTTCTAAGCCATTCAG
TCCAAAGATTCTTGTGGCAAGAGTAAATGCGATCCTTCGCAGAACTTTGGGAGCGGTCGGCAATGATTCGCTGGAGGCAG
GCGGTATTACGATTGACAAGTCAGCACATATCGTGAAGATTGATGGAACACCGGTTGAACTTAGTTATAAAGAATTTGAA
TTGTTGACCTACTTTATAGAAAATCAGGGAATTGCGCTTTCCAGAGAGAAAATATTGAATAATGTATGGAATTATGATTA
TTTTGGTGATGCAAGAACAATTGATACACATGTGAAGAAACTGAGAAGTAAATTAGGCGATAAGGGCGAATATATCAAAA
CAATCTGGGGCATGGGATATAAGTTTGAAGTTCAGAGCACGGAGAAATAA

Protein sequence :
MERAKILVVDDESRMRKLVKDFLTREGYMVLEAGDGMEAMDLFYEDKDIALIILDVMMPKMDGWQVCREVRETSKVPIIM
LTARSEERDELQGFELGVDEYISKPFSPKILVARVNAILRRTLGAVGNDSLEAGGITIDKSAHIVKIDGTPVELSYKEFE
LLTYFIENQGIALSREKILNNVWNYDYFGDARTIDTHVKKLRSKLGDKGEYIKTIWGMGYKFEVQSTEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-39 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 4e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 7e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 4e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 6e-41 49
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1202. Protein 1e-39 43
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 9e-41 43
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-38 42
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 3e-39 41
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 7e-39 41
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 2e-39 41
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 2e-38 41
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_22280 YP_007787241.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 2e-30 42