Gene Information

Name : RO1_36400 (RO1_36400)
Accession : YP_007779667.1
Strain : Roseburia intestinalis XB6B4
Genome accession: NC_021012
Putative virulence/resistance : Resistance
Product : Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3606121 - 3606702 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGCCAATTAATTTATCAAAAGGACAGAAAGTAGATTTAACAAAAGGAAATCCGGGACTGAAAAATATCATGGTTGGTCT
TGGCTGGGATGTCAATGCATTTGATTCCGGTGTAGATTTTGACCTGGATGCAGCAGCATTTATGCTGGGAGCAGATGGAA
AGTGCCCGACAGACAAAGAATTTGTATTTTATGGAAATCTGGCTCATCCGAGCGAGTCTGTAAAACATATGGGCGATAAC
TTAACCGGAGAGGGAGAAGGCGATGACGAGCAGATCCAGATCGATCTTTCCAAAGTACCGGCAAACATTGAGAGAATCGC
ATTTACCGTAACGATCTATGAGGCGGAGGCAAGACGCCAGAATTTTGGACAGGTATCTAATTCTTTCATTCGTCTGGTGG
ATGAGACAACCGGAAAAGAAATGATCCGCTATGACTTAGGAGAGGATTTCTCCATTGAGACAGCAGTCGTTGTCGGTGAA
TTATACAGACATAACGGCGAATGGAAATTTAATGCGATCGGAAGCGGCTTCCAGGGCGGACTCGCAGCACTTTGCGGACA
CTATGGAATTGAAGTGGCATAA

Protein sequence :
MPINLSKGQKVDLTKGNPGLKNIMVGLGWDVNAFDSGVDFDLDAAAFMLGADGKCPTDKEFVFYGNLAHPSESVKHMGDN
LTGEGEGDDEQIQIDLSKVPANIERIAFTVTIYEAEARRQNFGQVSNSFIRLVDETTGKEMIRYDLGEDFSIETAVVVGE
LYRHNGEWKFNAIGSGFQGGLAALCGHYGIEVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-55 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-56 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-51 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-48 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RO1_36400 YP_007779667.1 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 BAC0389 Protein 2e-55 56
RO1_36400 YP_007779667.1 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 BAC0390 Protein 3e-52 55