Gene Information

Name : XNR_4737 (XNR_4737)
Accession : YP_007748062.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Virulence
Product : Two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5388749 - 5389414 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence : 
GTGAACCGGATACTCATCGTCGAGGACGAGGAGCGCATCGCCTCCTTCATCGAGAAGGGGCTGCGCGCCAACGGCTTCAC
CACCACGGTCGCCGCCGACGGGGAGAGCGCCCACGACTACGCCCTCACCGGCGGCTTCGACCTGGTCCTGCTGGACATCG
GGCTGCCGGGCCGGGACGGCTTCACCGTCCTGCGGGACCTGCGCGAGGCCCGGGTGACGGCGCCGGTGATCGTGCTGACC
GCACGGGACTCCGTACGGGACACGGTGGCCGGTCTGGAGGGCGGGGCCGACGACTGGATGACCAAGCCGTTCCGGTTCGA
GGAGCTGCTGGCCCGGGTGCGGCTGCGGCTGCGCACCGCCGCCCGCGCGCCGGAGGTGACCGTCCTGCGGTGCGGCGAGG
TCACCCTCGACCTGCGCACCCGGCGGGCCCGATCCGGCGAGGAGACCGTCGACCTGACGGCCCGCGAGTTCGTCCTGCTG
GAACTCTTCCTGCGCCACCCCGGCCAGGTCCTCTCCCGCGAGCAGATCCTCTCCCAGGTCTGGGGGTACGACTTCGACCC
GGGCTCCAACATCGTCGACGTCTACGTGCGCGCCCTGCGCCGCAAGCTCGGCGCGCACCGGATCGAGACGGTGCGCGGGA
TGGGGTACCGGCTGCCGCAGGGGTGA

Protein sequence : 
MNRILIVEDEERIASFIEKGLRANGFTTTVAADGESAHDYALTGGFDLVLLDIGLPGRDGFTVLRDLREARVTAPVIVLT
ARDSVRDTVAGLEGGADDWMTKPFRFEELLARVRLRLRTAARAPEVTVLRCGEVTLDLRTRRARSGEETVDLTAREFVLL
ELFLRHPGQVLSREQILSQVWGYDFDPGSNIVDVYVRALRRKLGAHRIETVRGMGYRLPQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_4737 YP_007748062.1 Two component system response regulator BAC0197 Protein 2e-34 49
XNR_4737 YP_007748062.1 Two component system response regulator HE999704.1.gene1528. Protein 3e-32 45
XNR_4737 YP_007748062.1 Two component system response regulator BAC0125 Protein 1e-33 45
XNR_4737 YP_007748062.1 Two component system response regulator BAC0083 Protein 1e-35 45
XNR_4737 YP_007748062.1 Two component system response regulator BAC0638 Protein 4e-28 45
XNR_4737 YP_007748062.1 Two component system response regulator BAC0308 Protein 2e-32 43
XNR_4737 YP_007748062.1 Two component system response regulator BAC0111 Protein 2e-35 43
XNR_4737 YP_007748062.1 Two component system response regulator AE015929.1.gene1106. Protein 9e-28 42
XNR_4737 YP_007748062.1 Two component system response regulator BAC0347 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_4737 YP_007748062.1 Two component system response regulator VFG1389 Protein 2e-29 45
XNR_4737 YP_007748062.1 Two component system response regulator VFG0596 Protein 4e-31 44
XNR_4737 YP_007748062.1 Two component system response regulator VFG1390 Protein 9e-30 42