Gene Information

Name : XNR_4529 (XNR_4529)
Accession : YP_007747855.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5150635 - 5151210 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAATGTCTCGCTGACCAAGGAGGCGCCTGGCCTGACCGCGGTCACCATCGGTCT
GGGGTGGGACGTCCGTACCACCACGGGTACCGACTTCGACCTCGACGCCAGCGCCATCCTGACGAACGCCGACGGCAAGG
TCACCAGCGACCAGGGCTTCGTGTTCTTCAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGCGACAACATC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGGTGAACCTGGCCGGCGTCCCGGCCGAGGTGACCAAGATCGTGTT
CCCGGTCTCCATCTACGACGCGGAGAACCGCCAGCAGTCCTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTGGTCAACC
AGGCCAACGACCAGGAGATCGCCCGCTACGACCTCTCCGAGGACGCCTCCACGGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCCTCGGGTCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVTIGLGWDVRTTTGTDFDLDASAILTNADGKVTSDQGFVFFNNLKSPDGSVEHTGDNI
TGEGEGDDEQIKVNLAGVPAEVTKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQANDQEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-62 67
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-58 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-60 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-32 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_4529 YP_007747855.1 Tellurium resistance protein TerD BAC0389 Protein 8e-61 65
XNR_4529 YP_007747855.1 Tellurium resistance protein TerD BAC0390 Protein 4e-59 63
XNR_4529 YP_007747855.1 Tellurium resistance protein TerD BAC0392 Protein 8e-28 42