Gene Information

Name : XNR_2820 (XNR_2820)
Accession : YP_007746182.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3208507 - 3209082 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGCGTTTCCCTGGCCAAGGGCGGCAATGTCTCTCTCAGCAAGGAAGCCCCCGGGCTGACCGCGGTCCTTGTCGGGCT
CGGCTGGGACGTCCGCACGACGACCGGCACCGACTACGACCTCGACGCCAGCGCCCTGCTCTGCGACGAGTCCGGCAAGG
TCCTCTCCGACCAGCACTTCATCTTCTACAACAACCTGACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTC
ACCGGCGAGGGCGACGGCGACGACGAGGCCGTCAAGGTCAACCTCGCCGCGGTCCCGCCGCAGGTCACCCGCATCGTCTT
CCCCGTCTCCATCCACGACGCGGAGTCCCGCGGCCAGAGCTTCGGCCAGGTCCGGAACGCCTTCATCCGCGTGGTGAACC
AGGCCGGCGGCGCCGAGATCGCGCGGTACGACCTCACGGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCCACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCGGGCCTGGCCGGGATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLAKGGNVSLSKEAPGLTAVLVGLGWDVRTTTGTDYDLDASALLCDESGKVLSDQHFIFYNNLTSPDGSVEHTGDNL
TGEGDGDDEAVKVNLAAVPPQVTRIVFPVSIHDAESRGQSFGQVRNAFIRVVNQAGGAEIARYDLTEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLAGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-63 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-61 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-60 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 66
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_2820 YP_007746182.1 Tellurium resistance protein BAC0389 Protein 1e-60 68
XNR_2820 YP_007746182.1 Tellurium resistance protein BAC0390 Protein 5e-64 67
XNR_2820 YP_007746182.1 Tellurium resistance protein BAC0392 Protein 2e-26 44