Gene Information

Name : XNR_1434 (XNR_1434)
Accession : YP_007744826.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1709778 - 1710443 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGGCTGGCCCTGTCCCTGGCGAAGGGACTGACCGCCGAGGGATACGCCGT
GGACGTCGTCCATGACGGGCTGGAGGGACTGCACCGGGCCAGCGAGAGCCCGTACGACCTGCTGGTCCTGGACATCATGC
TGCCCGGCATGAACGGCTACCGGGTCTGCGCCGCCCTGCGCGCCGCCGGGAACGACGTGCCGATCCTGATGCTGACCGCC
AAGGACGGCGAGTACGACGAGGCCGAGGGGCTCGACACGGGCGCCGACGACTACCTGACCAAGCCCTTCAGCTACGTGGT
GCTGGTCGCCCGGGTGCGGGCCCTGCTCCGCCGCCGCGCGGGTGCCGGCGCCTCCCCGGTGCACACGGTGGGCGGGCTGC
GCGTCGACACGGCGGCCCGGCGCGTGCAGCGGGACGGCGACGAGGTCGCGCTGACCGCCAAGGAGTTCGCGGTGCTGGAA
CAACTGGTGCTGCGCGCGGGCCAGGTGGTCTCCAAGGCCGACATCCTGGAACACGTCTGGGACTTCGCCTACGACGGCGA
CCCCAACATCGTCGAGGTCTACATCAGCGCCCTGCGCCGCAAGCTCGGCGCCCAGGCCATCCGGACCGTGCGCGGCATGG
GATACCGGCTGGAGGCGGGCCGGTGA

Protein sequence :
MRLLIVEDEKRLALSLAKGLTAEGYAVDVVHDGLEGLHRASESPYDLLVLDIMLPGMNGYRVCAALRAAGNDVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVRALLRRRAGAGASPVHTVGGLRVDTAARRVQRDGDEVALTAKEFAVLE
QLVLRAGQVVSKADILEHVWDFAYDGDPNIVEVYISALRRKLGAQAIRTVRGMGYRLEAGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_1434 YP_007744826.1 Two-component response regulator BAC0083 Protein 4e-38 47
XNR_1434 YP_007744826.1 Two-component response regulator BAC0638 Protein 9e-34 47
XNR_1434 YP_007744826.1 Two-component response regulator BAC0111 Protein 2e-37 45
XNR_1434 YP_007744826.1 Two-component response regulator BAC0197 Protein 5e-36 45
XNR_1434 YP_007744826.1 Two-component response regulator U82965.2.orf14.gene. Protein 2e-26 45
XNR_1434 YP_007744826.1 Two-component response regulator Y16952.3.orf35.gene. Protein 1e-24 44
XNR_1434 YP_007744826.1 Two-component response regulator BAC0125 Protein 2e-36 43
XNR_1434 YP_007744826.1 Two-component response regulator BAC0308 Protein 5e-36 43
XNR_1434 YP_007744826.1 Two-component response regulator NC_002516.2.879194.p Protein 5e-24 43
XNR_1434 YP_007744826.1 Two-component response regulator BAC0487 Protein 4e-23 42
XNR_1434 YP_007744826.1 Two-component response regulator BAC0347 Protein 1e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_1434 YP_007744826.1 Two-component response regulator VFG1389 Protein 4e-31 45
XNR_1434 YP_007744826.1 Two-component response regulator VFG0596 Protein 4e-34 44
XNR_1434 YP_007744826.1 Two-component response regulator VFG1390 Protein 8e-37 44
XNR_1434 YP_007744826.1 Two-component response regulator VFG0473 Protein 9e-27 42
XNR_1434 YP_007744826.1 Two-component response regulator VFG1386 Protein 1e-31 42