Gene Information

Name : G655_15430 (G655_15430)
Accession : YP_007709929.1
Strain : Pseudomonas aeruginosa B136-33
Genome accession: NC_020912
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3412408 - 3412686 bp
Length : 279 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGGCCGCGGCCCTGGTGTTGGACCAAGGCTACAGCCA
TATTGACGCCTGCCGTTCGCTGGGGGTGGTGGATTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG
GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGTTGGAG
CGGGAGAAAGCGATATTAAAAAAGCTACCGCTCTCTTGA

Protein sequence :
MSKQRRTFSAEFKREAAALVLDQGYSHIDACRSLGVVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE
REKAILKKLPLS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-36 100
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-17 56
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-18 54
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-18 54
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 9e-18 54
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 9e-18 54
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 9e-18 54
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-17 54
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 9e-18 54
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-17 54
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-18 54
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 9e-18 54
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-17 53
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 7e-17 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-17 48
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-17 48
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-17 47
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-17 47
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-17 47
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-17 47
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 9e-14 43
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G655_15430 YP_007709929.1 transposase VFG1553 Protein 1e-17 56
G655_15430 YP_007709929.1 transposase VFG1485 Protein 2e-18 54
G655_15430 YP_007709929.1 transposase VFG1123 Protein 4e-18 54
G655_15430 YP_007709929.1 transposase VFG0784 Protein 1e-17 47
G655_15430 YP_007709929.1 transposase VFG1566 Protein 4e-10 42