Gene Information

Name : G655_11285 (G655_11285)
Accession : YP_007709104.1
Strain : Pseudomonas aeruginosa B136-33
Genome accession: NC_020912
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2401270 - 2401578 bp
Length : 309 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGTCCGCGGCCCTGGTGTTGGACCAAGGCTACAGCCA
TATCGACGCCTGCCGTTCGCTGGGGGTGGTGGATTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG
GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGTTGGAG
CGGGAGAAAGCGATATTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAACTCGATCGTACGCGCTGA

Protein sequence :
MSKQRRTFSAEFKRESAALVLDQGYSHIDACRSLGVVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE
REKAILKKATALLMSDELDRTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-42 99
l7045 CAD33744.1 - Not tested PAI I 536 Protein 7e-23 58
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 7e-23 58
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 7e-22 57
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-21 57
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-18 55
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-22 55
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-22 55
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 55
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-22 55
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 55
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-22 55
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-22 55
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-22 55
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-22 51
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-22 51
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-20 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-20 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-20 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 9e-21 50
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 1e-13 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G655_11285 YP_007709104.1 transposase VFG1485 Protein 3e-23 58
G655_11285 YP_007709104.1 transposase VFG1553 Protein 3e-22 57
G655_11285 YP_007709104.1 transposase VFG1123 Protein 3e-22 55
G655_11285 YP_007709104.1 transposase VFG0784 Protein 4e-21 50