Gene Information

Name : merP1 (OAN307_c17650)
Accession : YP_007704064.1
Strain : Octadecabacter antarcticus 307
Genome accession: NC_020911
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic componentMerP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1743688 - 1743984 bp
Length : 297 bp
Strand : -
Note : -

DNA sequence :
ATGAAACTCCGCACCTCCGTTTTCGCCCTGATTGGCTTTATGGCTGCCGCCCCTGTCTTTGCGGCAGAGCAAACAGTCAC
ATTCTCAGCTCCCGGCATGACTTGTGCCAGCTGCCCCTTCATCGTTGAATCAGCGATGAGCGGCGTCGATGGGGTTCTAA
CAGTAACTGCTGACGCCGACACCAGAACGGCGCTGGTTGTCTTTGATGACGCCATTGTCAGTGCAACAGATATTGCGTTC
GCCTCTACGTCCGCGGGTTACGAAGCTGAGCTTGACACCGATGACAGTAATTCCTGA

Protein sequence :
MKLRTSVFALIGFMAAAPVFAAEQTVTFSAPGMTCASCPFIVESAMSGVDGVLTVTADADTRTALVVFDDAIVSATDIAF
ASTSAGYEAELDTDDSNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 8e-10 48
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-09 48
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-11 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-09 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-09 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-09 44
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-09 44
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-09 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-09 44
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-08 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP1 YP_007704064.1 mercuric transport protein periplasmic componentMerP BAC0679 Protein 6e-10 48
merP1 YP_007704064.1 mercuric transport protein periplasmic componentMerP BAC0678 Protein 6e-10 47
merP1 YP_007704064.1 mercuric transport protein periplasmic componentMerP BAC0231 Protein 6e-10 46
merP1 YP_007704064.1 mercuric transport protein periplasmic componentMerP BAC0675 Protein 6e-10 46