Gene Information

Name : OA238_118p0120 (OA238_118p0120)
Accession : YP_007702165.1
Strain :
Genome accession: NC_020909
Putative virulence/resistance : Unknown
Product : transposon-associated protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 11984 - 12331 bp
Length : 348 bp
Strand : -
Note : IS66 orf2-like

DNA sequence :
ATGATCCCTTTTCTGGCGGATGCAAAGATCTGGCTTGCGGCCGGGGTGACGGATATGCGGCGCGGTTTTAACGGGCTAGC
GGCCCAGACAGAGCAGGTTCTGGCGGGAGATCCATACTCCGGTCATCTGTTTTTGTTCCGTGGTCGGCGCGGCGATCAGA
TCAAAGTCATTTGGTGGGACGGACAAGGGGCCTGTCTGTTTACTAAGCGCCTTGAGCGCGGACGCTTTGTGTGGCCCGCC
GCTAAGGATGGAAAGATCAGCTTAAGCCGGGCGCAGCTTGCGATGCTGATGGAAGGCATAGACTGGCGCATGCCACAAAA
GACGTGGCGGCCCGCCATGGTCGGGTGA

Protein sequence :
MIPFLADAKIWLAAGVTDMRRGFNGLAAQTEQVLAGDPYSGHLFLFRGRRGDQIKVIWWDGQGACLFTKRLERGRFVWPA
AKDGKISLSRAQLAMLMEGIDWRMPQKTWRPAMVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-35 64
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-35 64
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-32 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-31 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-32 64
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-32 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-32 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-32 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-32 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-32 64
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-32 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-32 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-32 64
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-31 64
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-35 63
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-32 63
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-24 62
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-34 58
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-34 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-34 58
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-33 56
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-33 56
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-28 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-31 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-31 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1698 Protein 2e-32 64
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1709 Protein 1e-32 64
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG0792 Protein 1e-32 64
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1665 Protein 2e-35 63
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1052 Protein 2e-32 63
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1517 Protein 7e-25 62
OA238_118p0120 YP_007702165.1 transposon-associated protein VFG1737 Protein 2e-34 58