Gene Information

Name : OA238_c43010 (OA238_c43010)
Accession : YP_007701664.1
Strain : Octadecabacter arcticus 238
Genome accession: NC_020908
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4564369 - 4564722 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
GTGATTGTCGCGGGGCAGCGGCTGCCGATTGTGATTGCGACCAAGCCGGTGGATTTTCGTCGTGGTCATGACGGGCTAGC
AGCAGCGGTGCAGAACGAACTGGGGCTTGATCCGCATTCCGGTCTGACGGTGGTGTTCCGCTCCAAGCGGGGTGACAGGT
TGAAGATTCTCCTATGGGATGGCACCGGACTGGTACTGATCTACAAGCGTCTTGAAGTTTCCAACTTCGTGTGGCCCAAG
ATCCATGACGGTGTCATGCAGCTTTCTCGGGCCCAGTACGAGGCGTTATTTGAAGGTTTGGATTGGCTGCGAATGACGCC
GAAACAGGTTGCCCCGCCGACTGCGGCAGGGTGA

Protein sequence :
MIVAGQRLPIVIATKPVDFRRGHDGLAAAVQNELGLDPHSGLTVVFRSKRGDRLKILLWDGTGLVLIYKRLEVSNFVWPK
IHDGVMQLSRAQYEALFEGLDWLRMTPKQVAPPTAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-13 50
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-13 50
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-13 49
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-12 49
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-13 49
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-12 49
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-12 49
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-12 49
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-12 49
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-13 49
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-12 49
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-13 49
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 49
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-13 49
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-12 49
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-12 48
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-16 47
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-12 45
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-12 45
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-14 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-14 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-13 43
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-13 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-13 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG1698 Protein 6e-13 49
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG1709 Protein 4e-13 49
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG0792 Protein 4e-13 49
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG1665 Protein 1e-13 49
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG1052 Protein 8e-13 48
OA238_c43010 YP_007701664.1 IS66 Orf2 family protein VFG1737 Protein 3e-14 43