Gene Information

Name : OA238_c25860 (OA238_c25860)
Accession : YP_007700091.1
Strain : Octadecabacter arcticus 238
Genome accession: NC_020908
Putative virulence/resistance : Unknown
Product : putative IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2740865 - 2741140 bp
Length : 276 bp
Strand : +
Note : -

DNA sequence :
GTGATCTATCCATCACAGGCGGTTCGGATTGTTATTGCGACCAAGCCGGTGGATTTCCGCAAGGGCCATGATGGACTTGC
TGCACTGCTCGAACGTGAACTGGACCTTGACCCGCACTCTGGCATCATTGTTGTGTTCCGCGCCAAACGTGGCGACCGGA
TTAAGGTGTTGCTTTGGGACGGGTCTGGCTTGGTGCTTTGCTACAAGCGGTTGGGACAGGGCAAGTTCGCTTGGCCGAAA
GTTCAGGACGGGTTGATGCGCTTGTCCAAGGGGTAA

Protein sequence :
MIYPSQAVRIVIATKPVDFRKGHDGLAALLERELDLDPHSGIIVVFRAKRGDRIKVLLWDGSGLVLCYKRLGQGKFAWPK
VQDGLMRLSKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-09 46
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-06 43
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-08 43
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-08 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-06 43
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-06 43
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-06 43
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-06 43
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-06 43
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-06 43
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-06 43
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-06 43
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-06 43
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-06 43
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-06 43
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-07 42
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-08 41
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-08 41
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1517 Protein 2e-06 43
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1698 Protein 4e-07 43
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1052 Protein 8e-07 43
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1709 Protein 4e-07 43
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG0792 Protein 4e-07 43
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1665 Protein 8e-08 42
OA238_c25860 YP_007700091.1 putative IS66 Orf2 family protein VFG1737 Protein 2e-08 41