Gene Information

Name : SHJGH_7753 (SHJGH_7753)
Accession : YP_007696749.1
Strain : Streptomyces hygroscopicus TL01
Genome accession: NC_020895
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8826365 - 8827039 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
GTGGACGACGACGCGACCGTCGCCGAGATCGTCGCCGGATACCTCGGCCGCGCCGGATACGCGGTCGACCGCGCCGCCGA
CGGCCCCACCGCCCTCACCCGCGCCGCCGCCCACTGGCCGGACCTGGTCGTACTGGACCTGATGCTGCCCGGCATGGACG
GACTGGAGGTCTGCCGGCGGCTGCGCGCGCGGGCCCCCGTCCCCGTCGTCATGCTCACCGCCCGCGGTGACGAGGACGAC
CGCATCACGGGTCTGGAGGTCGGCGCCGACGACTACGTGACCAAGCCGTTCAGCCCCCGCGAACTGGTCCTGCGGGTGCA
GTCCGTGCTCCGCCGGGCGCTGCCCGGCACGGGCACCGGGCCGCTGACCGCGGCCGGTGTCACCGTCGACCCGGCCGCCC
GCCGCGCCACCAAGAACGGTACCGAACTCGCCCTCACGCTACGGGAGTTCGACCTCCTCGCCTTCTTCCTGCGGCACCCG
GGGAGGGCCTACGGCCGGGAGGACCTGATGCGCGAGGTGTGGGGCTGGGACTTCGGCGACCTGTCCACCGTGACGGTCCA
CATCCGCCGGCTGCGCGGCAAGGTCGAGGACGACCCCGCCCGGCCGCGCCTGATCCAGACCGTGTGGGGCGTCGGCTACC
GCTTCGAGCCGAGCGGCGCGGAAGGGGAGGGCTGA

Protein sequence :
MDDDATVAEIVAGYLGRAGYAVDRAADGPTALTRAAAHWPDLVVLDLMLPGMDGLEVCRRLRARAPVPVVMLTARGDEDD
RITGLEVGADDYVTKPFSPRELVLRVQSVLRRALPGTGTGPLTAAGVTVDPAARRATKNGTELALTLREFDLLAFFLRHP
GRAYGREDLMREVWGWDFGDLSTVTVHIRRLRGKVEDDPARPRLIQTVWGVGYRFEPSGAEGEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-35 46
SHJGH_7753 YP_007696749.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-31 45
SHJGH_7753 YP_007696749.1 two-component system response regulator BAC0197 Protein 2e-25 44
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_011595.7057856.p0 Protein 2e-29 43
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_010410.6002989.p0 Protein 2e-29 43
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_010400.5986590.p0 Protein 7e-30 43
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_002952.2859905.p0 Protein 5e-35 42
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-35 41
SHJGH_7753 YP_007696749.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-33 41
SHJGH_7753 YP_007696749.1 two-component system response regulator BAC0083 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJGH_7753 YP_007696749.1 two-component system response regulator VFG1389 Protein 6e-27 44
SHJGH_7753 YP_007696749.1 two-component system response regulator VFG0596 Protein 5e-24 43
SHJGH_7753 YP_007696749.1 two-component system response regulator VFG1563 Protein 5e-31 42
SHJGH_7753 YP_007696749.1 two-component system response regulator VFG1390 Protein 2e-25 41
SHJGH_7753 YP_007696749.1 two-component system response regulator VFG1702 Protein 7e-31 41